CAZyme Information: MGYG000001322_00346

Basic Information

• Species: Gemmiger variabilis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger variabilis
• CAZyme ID: MGYG000001322_00346
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808	MGYG000001322_9|CGC6	86918.64	5.7794

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001322	3237471	Isolate	not provided	not provided

• Gene Location: Start: 296440; End: 298866 Strand: +

Full Sequence      

MQNNTTRQLTLEQKCALLSGGSTFQTRALPGCGIPAIWLSDGPHGVRKQAGPADHLGINP
SEPATCFPTASAVASSWDPALGEEIGRALGQEAAAQDVAVVLGPGLNTKRSPLCGRNFEY
FSEDPYLAGKMAAAYIRGIQENGIAACPKHFAANNQELRRMASDSIVDERTLRELYLTNF
EIAVTEGKPRSIMTSYNMVNGTYANENLHLLQEILRDTWGFDGAVVTDWGGSNDHVLGVK
NGSTLEMPAPGLDSARELCKAVRDGKISEVDINARLEELLTLIDQTTGALEKAPKTIDWD
AHRALARKAAAESIVLLKNKGGLLPLDPAAKVAVIGDFAKTPRYQGAGSSLVNAPRVDSF
LDVLEASGIQTVGYAQGFDRQGKPDGRLQAQAVELAAKADVVLLFLGLDEVKESEGLDRS
DMKLAQNQIDLLLAVHRTNPRLAVILSCGSAVETGWQSHCEALLWAGLGGQAGAGAVLDA
LTGKVNPAGRLAETWPIHCEDNPSYKNFGTPGRNVEYREGLYVGYRYYQTAGVPVAYPFG
YGLSYTTFAYRDLTATPTGVSVTVENTGDRAGDEVVQVYIAKPDAKIFRPAQELKGFARV
HLEAGESRTVTIPLDDKAFRYWNDPANRWAVEGGDYEVRVGGSSADIRLTATVAVAPSGD
ADPYAGLALPHYQGGQVQDVPDEEFAALLGHAIPVAKVAIDRNMTLGEIGHARSPLGWLV
HVIHKHLLDKSLASGTPDLNLLFNYNMPLRAIAKMTGGIVSMGMVDALVMELKGFWIIGI
VRLLVEFVKNDRANKAMEKRLSEGGRKP

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	242	2.7e-67	0.9398148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.79e-87	65	648	118	758	beta-glucosidase BglX.
COG1472	BglX	1.91e-69	33	340	59	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	8.70e-65	9	628	60	757	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.84e-47	314	525	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	3.51e-38	33	282	65	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB27517.1	0.0	9	801	10	802
CBL01314.1	0.0	7	801	8	802
AXA81990.1	0.0	7	801	8	804
CBK98877.1	0.0	7	801	8	804
QOY61156.1	0.0	7	802	8	803

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.46e-196	7	655	10	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.10e-186	1	663	1	671	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.02e-132	3	655	5	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.60e-131	3	655	5	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	6.16e-119	8	647	12	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	7.97e-196	7	655	10	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	6.78e-183	7	695	10	730	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.20e-180	7	663	10	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	6.01e-128	8	652	52	742	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
B0Y3M6	1.54e-123	5	647	9	822	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.970731	0.029089	0.000088	0.000048	0.000029	0.000052

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001322_00346.