CAZyme Information: MGYG000001322_00803

Basic Information

• Species: Gemmiger variabilis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger variabilis
• CAZyme ID: MGYG000001322_00803
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440	MGYG000001322_11|CGC2	50060.18	6.1104

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001322	3237471	Isolate	not provided	not provided

• Gene Location: Start: 52197; End: 53519 Strand: -

Full Sequence      

MHGPITVHSDHRTLLRDGTPFFWLADTCWSAFTNITDEEWDHYLDRRAEQGFTVLQLNTL
TQWDRCGAPRTRHPFATEDGIRYDFTRPDPAYFAHAQAMCRRAVDKGFTLALVVMWCNYV
PDTWASHIFPDNVLPEELVEPVVRTVCETFREFNPVWIVSGDTDFKSEAARTRYRQVTEL
VEQYGPGLPKAYHICGRSADLPDWFADHADFYLYQSGHNRAGQDCTFTLAEQFAARTPRR
PVINSEPCYEQMGFSHKEYGRFRRSDTRRALWQSLLAGASAGITYGAHGVWNWQRDNAPA
QQLIRHPGEEPVHFGEGFLRALSWDKALTFPGAADYAFARRFWLERAPALPEPCQEILAA
YTPQVRAARWGQEIVIYLPVNAPLPLQGDWSGYTAEALDLSGAGTRAPVSLDVQADGTTR
LGMHPFYEDALLILRANPRA

Enzyme Prediction     

No EC number prediction in MGYG000001322_00803.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	3	386	4.8e-99	0.8883495145631068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	3.09e-97	10	346	1	320	Protein of unknown function (DUF4038). A family of putative cellulases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT29801.1	9.84e-141	5	437	4	425
QEI31005.1	4.42e-135	5	425	4	413
QHB23513.1	4.42e-135	5	425	4	413
ASR46006.1	1.73e-126	5	433	4	422
QQR00078.1	7.94e-125	5	435	2	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QFU_A	1.78e-21	2	348	28	372	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001322_00803.