CAZyme Information: MGYG000001323_00887

Basic Information

• Species: Providencia rettgeri_D
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia rettgeri_D
• CAZyme ID: MGYG000001323_00887
• CAZy Family: GT26
• CAZyme Description: UDP-N-acetyl-D-mannosaminuronic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
255	MGYG000001323_26|CGC1	28511.63	9.6145

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001323	4749568	Isolate	not provided	not provided

• Gene Location: Start: 214387; End: 215154 Strand: -

Full Sequence      

MESSSTQSSSVTQPSIPQYSIRGHNIWGFKNMAHFLDYLFAGGETKTGTLVAINAEKVMI
AEQDTALNTLLGQAEYLYADGISIVRAIRRKYPQAEVSRVAGADLWEGLMERAGKEGTPV
FLVGGKPEILEQTESKLRSQWNVNIVGSQNGYFTAEERSALFERIRASGAKIVTVAMGSP
KQEIFMRDCRSVYPDALYMGVGGTYDVFTGHVKRAPKVWQNLGLEWLYRLLSQPSRITRQ
FKLLKFLGYYYGGKL

Enzyme Prediction     

No EC number prediction in MGYG000001323_00887.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT26	71	240	2.1e-65	0.9883040935672515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK03692	PRK03692	0.0	15	255	3	243	putative UDP-N-acetyl-D-mannosaminuronic acid transferase; Provisional
COG1922	WecG	3.95e-107	14	255	5	249	UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family [Cell wall/membrane/envelope biogenesis].
TIGR00696	wecG_tagA_cpsF	7.20e-87	70	246	2	177	bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family. The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam03808	Glyco_tran_WecB	6.91e-72	74	241	1	169	Glycosyl transferase WecB/TagA/CpsF family.
cd06533	Glyco_transf_WecG_TagA	1.41e-70	73	239	3	169	The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWQ24393.1	1.45e-184	1	255	1	255
QKG46730.1	1.45e-184	1	255	1	255
QWQ16724.1	1.45e-184	1	255	1	255
BBU99294.1	1.45e-184	1	255	1	255
BBV14264.1	1.45e-184	1	255	1	255

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MPK_A	3.65e-35	44	246	29	231	ChainA, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_A Chain A, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9]
5WB4_A	1.98e-21	44	210	29	195	Crystalstructure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_B Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_C Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_D Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_E Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_F Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_G Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_H Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9]
5WFG_A	3.86e-21	44	210	29	195	Crystalstructure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_B Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_C Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_D Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_E Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_F Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7MYM6	2.19e-148	16	255	6	245	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=wecG PE=3 SV=1
B4F1W8	7.32e-147	15	255	5	245	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Proteus mirabilis (strain HI4320) OX=529507 GN=wecG PE=3 SV=1
C6DHE2	2.01e-138	12	255	6	249	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=wecG PE=3 SV=1
B1JPF1	2.57e-138	16	255	7	246	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=wecG PE=3 SV=1
B2K060	2.57e-138	16	255	7	246	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=wecG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001323_00887.