CAZyme Information: MGYG000001323_02280

Basic Information

• Species: Providencia rettgeri_D
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia rettgeri_D
• CAZyme ID: MGYG000001323_02280
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
562	MGYG000001323_31|CGC3	64279.05	8.4483

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001323	4749568	Isolate	not provided	not provided

• Gene Location: Start: 256629; End: 258317 Strand: +

Full Sequence      

MSNKNAPLIILQRSILLLFISFLAMYLLPGIYSHSPWKQDENYSFGIIQTMYETGKWLVP
TNAGEPFMEKPPLYYWVAAITSHLFSSFMPLYDAARSASLFFSVINFSFFILLARRFFQA
TDFTDTRIWVAFALYSCAPGIIRHSHDMFTDVALMAGATIGLYGLLGLIQQQKMRMSALW
LSLGTIVTMLSKGVFIPGVLWICLFLSPIFLAQCRTKQFWLHSLTAGLIALITILPWPIQ
LYLQHPDLFIVWFWENNIGRFFGFSVEKLGAKANLTRIPAAVSLFAFPSGLLAVAYFLRH
PIKRLFNSNEFLLALFPLLGVVFLQISASGRALYLLPFIAPMAILGTQTLLSFPEKILNG
IARFAAILWSVLILFLWACYFIALTGHQQEWLAPFSRWLPMSYQMPFSSIAFICALLITL
VWFLHNKIIPNPIPPAFHMMKNWLLGLCAVWGVILTLFLGWIDYAKGFEGVFVDLNQHLS
GQFTENDCMASDNIGESEAPMLYYYTGVLHQRQDQFEKPEQCRWLIVLSKTIKPAPQGME
LFWHNHRPDEFRENLVVYKVIE

Enzyme Prediction     

No EC number prediction in MGYG000001323_02280.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	11	461	1.7e-42	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	7.51e-26	9	442	3	449	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.74e-12	13	437	6	441	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	4.82e-04	70	237	2	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG5305	COG5305	0.001	67	298	94	324	Uncharacterized membrane protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UAC69887.1	7.43e-108	20	558	66	621
BAQ81035.1	1.88e-15	17	352	9	333
BAQ74745.1	2.50e-15	17	352	9	333
QNH77465.1	5.83e-15	17	366	9	344
QNL06661.1	5.83e-15	17	366	9	344

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4KC80	1.55e-15	17	352	9	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT1 PE=3 SV=1
Q4ZSZ0	3.27e-13	12	352	6	334	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=arnT PE=3 SV=1
Q02R27	1.33e-12	17	345	9	326	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1
B7VBN0	1.75e-12	17	345	9	326	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=arnT PE=3 SV=1
A6V1N8	4.07e-12	17	345	9	326	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.437610	0.556840	0.002735	0.000895	0.000531	0.001376

TMHMM  Annotations     

start	end
13	35
73	92
99	118
128	145
152	169
184	206
219	241
276	298
305	327
331	353
365	387
402	424
443	465