CAZyme Information: MGYG000001323_02772

Basic Information

• Species: Providencia rettgeri_D
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia rettgeri_D
• CAZyme ID: MGYG000001323_02772
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
192	MGYG000001323_32|CGC2	22152.41	8.47

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001323	4749568	Isolate	not provided	not provided

• Gene Location: Start: 357154; End: 357732 Strand: -

Full Sequence      

MKPFSIKPFLIAPLLLCCSSFVWSHGYVESPESRSYYCKQGVNTHCGAVQYEPQSIEGQK
GFPQYGPVDGKIASAGIAAFSPLDIQTANRWQRVILNSPDVRFKWRITAKHKTTKWEYFI
TKPDWQPNALLSRNQFTLTPFCKFERVEFPEETVEHKCVLPKKQKGYHVILAIWTIDDTQ
NAFYQVIDTEIN

Enzyme Prediction     

No EC number prediction in MGYG000001323_02772.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	25	189	6.6e-52	0.9887640449438202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	4.70e-89	1	192	1	194	N-acetylglucosamine-binding protein GbpA.
cd21177	LPMO_AA10	2.43e-71	25	188	1	178	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
COG3397	COG3397	1.42e-66	9	192	11	208	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
pfam03067	LPMO_10	3.45e-54	25	188	1	185	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
PRK07578	PRK07578	0.008	53	97	43	85	short chain dehydrogenase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKG45096.1	1.74e-147	1	192	1	192
QNN31331.1	1.74e-147	1	192	1	192
QLI97464.1	1.74e-147	1	192	1	192
BBV04522.1	1.01e-146	1	192	1	192
BBU95908.1	6.82e-145	1	192	1	192

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BEM_A	3.59e-65	25	192	1	169	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
6T5Z_A	5.79e-65	25	192	1	172	Crystalstructure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_B Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_C Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1]
5WSZ_A	4.02e-64	25	191	1	166	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]
2BEN_A	8.35e-64	25	192	1	169	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
2XWX_A	2.01e-50	25	192	1	179	Vibriocholerae colonization factor GbpA crystal structure [Vibrio cholerae],2XWX_B Vibrio cholerae colonization factor GbpA crystal structure [Vibrio cholerae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8EHY2	5.21e-56	24	192	27	196	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q87FT0	4.49e-52	1	192	1	202	GlcNAc-binding protein A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=gbpA PE=3 SV=1
Q5E183	2.68e-51	10	192	9	205	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=gbpA PE=3 SV=1
B5ESR7	2.68e-51	10	192	9	205	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain MJ11) OX=388396 GN=gbpA PE=3 SV=1
Q6LKG5	4.89e-51	7	188	7	199	GlcNAc-binding protein A OS=Photobacterium profundum (strain SS9) OX=298386 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000594	0.608140	0.390580	0.000248	0.000221	0.000192

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001323_02772.