CAZyme Information: MGYG000001324_00821

Basic Information

• Species: Fusobacterium periodonticum_D
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium periodonticum_D
• CAZyme ID: MGYG000001324_00821
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498	MGYG000001324_1|CGC7	59110.16	8.3449

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001324	2472878	Isolate	not provided	not provided

• Gene Location: Start: 874244; End: 875740 Strand: -

Full Sequence      

MKRECGVLLAISSLPSAYGIGDFGKEAYRFVDFLEASGQSLWQILPLCPVEYGNSPYQSP
STFAGNFLYLDLEELVHNEYLTQEDIDILKSEVSSVDYEYIKSQKESLLKKASQAFFCKN
AEESEFKKFQSENQFWLEDYSLFLSLNKKFKGKMWNTWEKGYKFRERKSIEEAKKEFEED
YKYESFIQYYFYKQWKKLKDYANSKGIKIIGDLPIYVANNSADTWQHPKLFCFNKHLKIK
AVAGCPPDYFSKNGQLWGNVLYGWEAMKKENYSWWEQRIKHSFLLYDVLRLDHFRGFASY
WAIRYGEKTAINGRWKIGPRIQFFRNLERKLKNIDIIAEDLGTLTADVFKLLRQTNYPNM
KVLQFGLTEWDNMYNPKNYTENSVAYTGTHDNMSMVEWYSTLNKNEKFICDENLKNFLKD
YNTNMWEPIQWRAIEALYASKSNRVIVPLQDILGLGADSRMNTPSTVGDNWAWRVYWEYR
HGDLENKLYNLAKRYQRI

Enzyme Prediction     

No EC number prediction in MGYG000001324_00821.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	9	490	9.5e-159	0.9838056680161943

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1640	MalQ	0.0	1	498	12	515	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14508	PRK14508	0.0	1	498	3	497	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	0.0	9	475	1	457	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	4.61e-159	1	498	26	526	disproportionating enzyme
TIGR00217	malQ	1.12e-125	2	474	13	490	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ24721.1	0.0	1	498	1	498
ATV71875.1	0.0	1	498	1	498
ATV57919.1	0.0	1	498	1	498
ATV66045.1	0.0	1	498	1	498
ATV67457.1	0.0	1	498	1	498

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TZ7_A	5.14e-124	3	479	22	487	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
2X1I_A	8.97e-118	1	498	1	500	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
6M6T_A	2.22e-117	2	475	4	474	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
5CPQ_A	6.79e-116	2	498	69	564	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
2OWC_A	8.51e-116	1	475	6	479	Structureof a covalent intermediate in Thermus thermophilus amylomaltase [Thermus thermophilus],2OWW_A Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose [Thermus thermophilus],2OWX_A THERMUS THERMOPHILUS AMYLOMALTASE AT pH 5.6 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59266	6.94e-147	11	497	3	485	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
P0A3Q1	1.32e-132	2	498	3	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
P0A3Q0	1.32e-132	2	498	3	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
O66937	1.06e-123	3	479	2	467	4-alpha-glucanotransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=malQ PE=1 SV=1
P72785	2.03e-117	2	497	4	499	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.458823	0.539869	0.000397	0.000369	0.000249	0.000281

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001324_00821.