CAZyme Information: MGYG000001324_02138

Basic Information

• Species: Fusobacterium periodonticum_D
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium periodonticum_D
• CAZyme ID: MGYG000001324_02138
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235	MGYG000001324_4|CGC1	27132.34	9.599

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001324	2472878	Isolate	not provided	not provided

• Gene Location: Start: 192345; End: 193052 Strand: -

Full Sequence      

MKKYLLAVVFLCLSILSYSNDTEALDQDTNTGIITQAKDFAKVKGKSKKQIFIDTLIPTI
EKIRTKIAEDKEYVKTLIEKEILTTEEKLYLEEMYIKYKVKSKSKTELVHKMVVPPTSFI
LGQASLESGWGNSKLAKEGNNLFAVRSSLRDPEKTVNLGPNQYYKRYESLEESLMDYVMT
LSRHSSYSNLRKAINNGEQTIVLIKHLGNYSEMKNLYEQRLTQIITKNNLFKYDN

Enzyme Prediction     

No EC number prediction in MGYG000001324_02138.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	116	230	1.4e-22	0.8828125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2992	Bax	5.15e-75	30	235	43	261	Uncharacterized FlgJ-related protein [General function prediction only].
PRK10356	PRK10356	9.25e-23	17	228	44	266	protein bax.
COG1705	FlgJ	3.69e-16	116	235	64	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	9.85e-13	114	177	13	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12713	flgJ	5.52e-09	116	198	202	299	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYR55725.1	1.17e-139	1	234	1	234
QNE69224.1	1.17e-139	1	234	1	234
ALQ38834.1	1.17e-139	1	234	1	234
ALQ39078.1	1.67e-139	1	234	1	234
ALQ34558.1	1.67e-139	1	234	1	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	5.17e-07	116	225	24	145	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	6.36e-07	116	225	24	145	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27297	6.86e-14	45	193	73	225	Protein bax OS=Escherichia coli (strain K12) OX=83333 GN=bax PE=4 SV=3
P15931	8.72e-06	116	225	173	294	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000210	0.999128	0.000177	0.000154	0.000146	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001324_02138.