CAZyme Information: MGYG000001325_01797

Basic Information

• Species: Fusobacterium_C gonidiaformans
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_C; Fusobacterium_C gonidiaformans
• CAZyme ID: MGYG000001325_01797
• CAZy Family: CE4
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252		30078.43	8.0431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001325	1848478	Isolate	not provided	not provided

• Gene Location: Start: 813441; End: 814199 Strand: -

Full Sequence      

MKKQKIEIPILMYHQFKEDMNHVGNSIATYVTRKQFEWHLRTLKFLGYETITFRDLEKIG
LENRLKKRYIILTVDDGYQDNYEILFPLLKQYQMKAVIYLVSDSYNRWDVEEYGVDKSPM
MKEEQVREMIESGLVEFGGHTLHHCDFDVVDEETARQEILENKKELEEKYGISLTSFAYP
YGHVTETAKKIVKEAGYHFAVSTSTGTGIITDDLYEMRRTSIDRTSVWRFLKRISRRYSV
YKGKKWMRQQEK

Enzyme Prediction     

No EC number prediction in MGYG000001325_01797.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	63	203	2.8e-34	0.9538461538461539

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	2.30e-56	69	225	1	157	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	7.49e-41	34	234	2	214	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10966	CE4_yadE_5s	1.69e-30	67	225	2	158	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.
cd10968	CE4_Mlr8448_like_5s	3.74e-27	68	207	1	141	Putative catalytic NodB homology domain of Mesorhizobium loti Mlr8448 protein and its bacterial homologs. This family contains Mesorhizobium loti Mlr8448 protein and its bacterial homologs. Although their biochemical properties are yet to be determined, members in this subfamily contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
pfam01522	Polysacc_deac_1	4.75e-27	63	200	2	124	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYV94487.1	2.20e-173	1	252	1	252
AYV92467.1	2.20e-173	1	252	1	252
AYZ74130.1	4.44e-173	1	251	1	251
AZW09990.1	4.44e-173	1	251	1	251
AVQ20890.1	3.65e-172	1	251	1	251

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DQ3_A	1.00e-15	6	222	7	215	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
4WCJ_A	4.55e-10	10	197	39	224	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
4U10_A	5.11e-10	10	201	6	232	Probingthe structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans],4U10_B Probing the structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans]
3VUS_A	9.87e-09	26	206	27	236	Escherichiacoli PgaB N-terminal domain [Escherichia coli K-12],3VUS_B Escherichia coli PgaB N-terminal domain [Escherichia coli K-12]
4F9D_A	1.86e-08	26	206	31	240	Structureof Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12],4F9D_B Structure of Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	1.73e-26	7	222	64	262	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q6G606	1.40e-10	11	202	48	251	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaB PE=3 SV=1
Q99QX2	1.40e-10	11	202	48	251	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaB PE=3 SV=1
Q8NUI6	1.40e-10	11	202	48	251	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaB PE=3 SV=1
Q7A349	1.40e-10	11	202	48	251	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001325_01797.