CAZyme Information: MGYG000001326_00581

Basic Information

• Species: Fusobacterium animalis
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium animalis
• CAZyme ID: MGYG000001326_00581
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336		39022.6	9.7935

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001326	2514029	Isolate	not provided	not provided

• Gene Location: Start: 585216; End: 586226 Strand: +

Full Sequence      

MENHKRILVIRLSSIGDIILTTAVLRAFKKKYPNYIIDFLVIDKFKDAISLSPYVDNLLI
YDKKKNDGLFNLIKFSKELSKNNYDYVFDLHSKFRSKIITFVLSKFYEVKAYTYKKRAFW
KSILVNLKLIKYKVDNTIVKNYFSAFKDFDLEYQGEKLNFSFEPELKEKFKEYKDYIVFA
VGASKETKKWTVEGFGKLAKKLFETYKKKIILVGGKEDSERCDTIGKISEDSVINLAGKL
SLKETGALLSQARFLLTNDSGPFHIARGVGCKTFVIFGPTSPEMFDFGENDVLVYNKIDC
SPCSLHGDKICPKKHFKCMKDLSYEKVFKIIENKEW

Enzyme Prediction     

No EC number prediction in MGYG000001326_00581.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	74	316	3.4e-47	0.9688888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	3.56e-74	4	333	1	328	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	5.91e-70	6	333	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	2.79e-29	74	303	3	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	4.09e-28	6	332	1	330	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	2.75e-21	5	280	6	291	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEO42444.1	2.86e-243	1	336	1	336
ALF21912.1	2.25e-240	1	336	1	336
QYR64732.1	1.85e-239	1	336	1	336
ALF18281.1	2.63e-239	1	336	1	336
QYR63522.1	2.63e-239	1	336	1	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	5.01e-19	3	332	7	342	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	5.09e-13	16	280	5	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	5.70e-12	16	280	5	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q57336	2.01e-10	2	297	6	304	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P37692	7.03e-07	6	283	2	293	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P37421	1.25e-06	6	283	2	293	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	25