CAZyme Information: MGYG000001326_00977

Basic Information

• Species: Fusobacterium animalis
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium animalis
• CAZyme ID: MGYG000001326_00977
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461		53789.95	6.7224

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001326	2514029	Isolate	not provided	not provided

• Gene Location: Start: 987645; End: 989030 Strand: +

Full Sequence      

MKVLFATGEAFPFVKTGGLGDVSYSLPKALVQKEKVDVRVILPKYSKISKDYFKNAKHLG
HKEIWVAHHNEYVGIEEVELEGIIYYFVDNERYFKRINVYGEFDDCERFLFFCKAVVETM
DITKFKPDIIHCNDWQTALIPIYLKERGIYDIKTIFTIHNLRFQGFFFNNVIEDLLEIDR
AKYFQEDGIKYYDMISFLKGGVVYSDYITTVSDSYAEEIKTPEFGEGIHGLFQKYDYKLS
GITNGIDKSSYPLFKKSHKILKAELQKKLGLDVEEETPLVAIITRLDRQKGLDYIVEKFD
EMMSLGIEFVLLGTGEKRYEHFFAYQEYLHKGRVCSYIGFNQQLSTEIYAGADIFLMPSV
FEPCGLSQMIAMRYGCIPVVRETGGLKDTVKPYNEYTGEGDGFGFKQANADDMMKTLRYA
IKMYHRPEVWKEIIKNAKKRDNFWDKPARRYKELYQKLLEG

Enzyme Prediction     

No EC number prediction in MGYG000001326_00977.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	457	1.2e-163	0.9978813559322034

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	1	459	1	479	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	1	458	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	1	459	1	464	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	457	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14099	PRK14099	2.08e-105	1	460	4	481	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASG31348.1	0.0	1	461	1	461
EEO42057.1	0.0	1	461	1	461
QYR63219.1	0.0	1	461	1	461
QYR68674.1	0.0	1	461	1	461
ALF18033.1	0.0	1	461	1	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	1.15e-81	1	458	1	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	2.81e-81	1	458	1	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	2.18e-80	1	458	1	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
1RZU_A	3.34e-79	1	459	1	476	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
1RZV_A	1.10e-76	2	459	2	476	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZV_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RF65	0.0	1	461	1	461	Glycogen synthase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) OX=190304 GN=glgA PE=3 SV=1
A4IS20	5.89e-151	1	460	1	476	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
O08328	2.37e-150	1	460	1	476	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1
B2V049	1.13e-146	1	458	1	475	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
B2TR28	6.45e-146	1	458	1	475	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001326_00977.