CAZyme Information: MGYG000001326_01375

Basic Information

• Species: Fusobacterium animalis
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium animalis
• CAZyme ID: MGYG000001326_01375
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243		29986.69	9.2439

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001326	2514029	Isolate	not provided	not provided

• Gene Location: Start: 1402203; End: 1402934 Strand: -

Full Sequence      

MIEKKIHYVWFGNTKPEKVLKCIESWKKNLPDYEIIEWNEKNFNIEEELKSNKFFRECYN
RKLWAFVSDYVRVKVLYNYGGIYLDTDMEIIKDITPLLDADMFLGYENEDTMSFGIVGVI
PKHKVFKKMYEFYQNEIWKSPLHIVTSILTEILEKEYHGKYRENNINIYPREYFYPFNHD
EEFTKDCITGNTYAIHWWGKSWKKNPKVYFLKYKHLPWWKKYPKHVAKLINYYFKKLFNF
RKE

Enzyme Prediction     

No EC number prediction in MGYG000001326_01375.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	18	99	1.7e-27	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	7.18e-73	1	243	81	320	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	3.19e-17	16	104	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	2.68e-08	16	169	62	233	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	1.16e-04	41	88	146	194	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.006	4	74	1	81	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGM23244.1	1.07e-189	1	243	1	243
EEO41665.1	1.07e-189	1	243	1	243
ALF21264.1	1.07e-189	1	243	1	243
QYR68241.1	2.52e-188	1	243	1	243
QYR62061.1	3.59e-188	1	243	1	243

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ZU30	5.00e-08	2	88	28	137	Subversion of eukaryotic traffic protein A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=setA PE=1 SV=1
P38287	1.73e-07	1	141	61	203	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
Q5UQW4	4.92e-07	1	208	1	217	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1
Q10323	5.45e-07	2	123	57	178	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
Q14BT6	4.19e-06	62	208	144	301	Alpha-1,4-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=A4gnt PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001326_01375.