CAZyme Information: MGYG000001326_01383

Basic Information

• Species: Fusobacterium animalis
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium animalis
• CAZyme ID: MGYG000001326_01383
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000001326_2|CGC8	44806.37	9.3945

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001326	2514029	Isolate	not provided	not provided

• Gene Location: Start: 1409446; End: 1410585 Strand: -

Full Sequence      

MKNLIKKINRIFQDYMRAKRLKIGKYIWDRKEKAKIVEGDNFLKDNSIKSILFLRYDGKI
GDMIVNSLMFREIKKVYPDIRIGVIARGAAIDIIKDNPNVDKIYEYYKDRKKIKDLALKI
KEEKYDLLIDFSEMLRVNQMMLINLCGARINTGLDRKDWELFDLSIESGKDFKWTEHITK
RYLAYLIKLGLKKENIDISYDIYLEDEKKYEAFFNEIKESKKLILNPYGASKHKSFNVET
LENIIDYLKDKDIAIILTYFGDKYKELEFLEKKYKYVYIPKEIESILDTAILIKKSDYVI
SPDTSIVHIASAFNKKMITVYPPKGGKYGVDHLVWAPKSEYSRVIFCKDKIGTYDEIDIN
TFNMQEMKEEILKMINNSD

Enzyme Prediction     

No EC number prediction in MGYG000001326_01383.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	115	324	5.7e-24	0.8133333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	4.74e-60	48	379	1	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	7.04e-39	50	377	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	1.23e-09	51	340	10	301	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	1.10e-05	116	323	4	211	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEO41657.1	1.38e-274	1	379	1	379
ALF21256.1	1.48e-269	1	379	1	379
ASG30995.1	2.74e-265	1	379	1	379
QYR62767.1	3.89e-265	1	379	1	379
QYR68233.1	5.53e-265	1	379	1	379

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27242	3.40e-13	48	361	40	341	Lipopolysaccharide 1,2-N-acetylglucosaminetransferase OS=Escherichia coli (strain K12) OX=83333 GN=waaU PE=4 SV=2
Q57336	2.12e-06	49	321	9	281	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
Q9R9D5	6.53e-06	61	360	5	311	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	8.81e-06	61	360	5	311	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001326_01383.