CAZyme Information: MGYG000001327_01127

Basic Information

• Species: Fusobacterium_A ulcerans
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A ulcerans
• CAZyme ID: MGYG000001327_01127
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		40510.19	9.3876

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001327	3483404	Isolate	not provided	not provided

• Gene Location: Start: 20396; End: 21430 Strand: -

Full Sequence      

MKILIIRFKQIGDAVLSSVICNTLKKSFPDAEIDYVVYEHIAPLFKNHPYIDNVISITKE
EQKNFFKYIIKVWKVTRKKYDIIIDIMSTPKSEFFTLFSLKSKYRIGRRKMYRGFTYTHK
ISEPIDSKDKVDKFLKMLDPLAENYKILYDNNYVIQIEEKEKEYMRKKMEESGINFSNPI
FICAINSRRSEKVYPLNKMECVIKKVIEELNPQIILFYSPSEKEFAKNFHSRLADSKNIF
SNIETASIRELAMLISNCDIFFGNEGGPRHIAQSLDIPSFAIFSSKSSKKEWLANPSKKH
QGVEPRDIYPECHLLSYKDCYSLIKPDYVVDKIKELYLQYCRSM

Enzyme Prediction     

No EC number prediction in MGYG000001327_01127.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	72	320	1.2e-32	0.9422222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	3.41e-55	1	336	2	329	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	4.22e-55	2	335	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	3.13e-16	2	283	7	288	lipopolysaccharide core biosynthesis protein; Provisional
PRK10964	PRK10964	2.69e-04	1	95	1	102	lipopolysaccharide heptosyltransferase RfaC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ27645.1	2.29e-253	1	344	1	344
SQJ15718.1	2.29e-253	1	344	1	344
BBA49699.1	2.59e-218	1	341	1	341
AVQ30518.1	8.21e-213	1	339	1	339
VEH40894.1	8.21e-213	1	339	1	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.81e-06	2	309	10	311	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	8.04e-12	12	285	5	278	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	1.11e-11	12	285	5	278	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
P44011	2.22e-09	2	300	3	305	Putative glycosyltransferase HI_0523 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0523 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000013	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001327_01127.