CAZyme Information: MGYG000001327_02786

Basic Information

• Species: Fusobacterium_A ulcerans
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A ulcerans
• CAZyme ID: MGYG000001327_02786
• CAZy Family: GT2
• CAZyme Description: N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000001327_5|CGC9	30887.98	8.2937

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001327	3483404	Isolate	not provided	not provided

• Gene Location: Start: 762962; End: 763732 Strand: +

Full Sequence      

MFDITASIVTYKTNKEELKKILNSFLNTKLKVKVWISDNSPSNDLEVEILNLNDQRIEYM
FNDCNGGYGYGHNKTIEKIKNNSKYHLIINPDIYFDRGVLEKIFEYMELNKDIGQLMPLV
KHPNGEIQYLCKRYPTPMNLFLRRFCPFKKIIEKQDYLYEMRDLGYEKIREVPLLSGCFM
FLRTEIFVKVNGFDERFFMYMEDFDLCRRIGEISKIIFYPEVEIFHNHAKESFKNKKMMW
EHIKSAIKYFDKWGWI

Enzyme Prediction     

No EC number prediction in MGYG000001327_02786.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	2.23e-39	7	228	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.16e-37	1	253	2	247	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd02526	GT2_RfbF_like	9.29e-11	6	210	1	186	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd02522	GT_2_like_a	3.59e-07	180	222	141	181	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06423	CESA_like	0.005	36	195	32	174	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQJ06913.1	2.34e-195	1	256	1	256
AVQ26781.1	2.34e-195	1	256	1	256
BBM37282.1	1.20e-113	1	256	1	281
ASQ48167.1	1.12e-106	1	255	1	258
AMD95023.1	9.73e-106	1	255	1	258

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36667	7.39e-16	8	249	5	243	Rhamnosyltransferase WbbL OS=Escherichia coli (strain K12) OX=83333 GN=wbbL PE=1 SV=1
P9WMY2	5.99e-15	9	229	10	238	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	5.99e-15	9	229	10	238	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001327_02786.