CAZyme Information: MGYG000001328_00495

Basic Information

• Species: Clostridium tertium
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium tertium
• CAZyme ID: MGYG000001328_00495
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000001328_3|CGC4	40988.74	4.6029

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001328	3807822	Isolate	not provided	not provided

• Gene Location: Start: 183562; End: 184620 Strand: +

Full Sequence      

MSIKKYKRKFILIGIIILLIGSVVLKNVLKKDGSIEIPNKISQKKNNDIFSDIDNLTSWI
VYWDLNVDSEINILNKKLSSISYFAVNFNENNDLIVPEKLEMYYNKTKSYNYEKYITIVN
DIVNDDGTSLLKDKEILNILLSDELSREKHINDIIYLAKEYGFDGIEIDYEQIKDDLALW
ENYILFINELYSEALTNNLKLRVVLEVNTPIDKLNFTEGPTYVMMCYNLHGSFSEAGEKS
NQYFIKELMDKMKEVPGEKSFAIPTGGFEWKDNGSTKSVSEAEAKQILIENKIEAKRDDK
SQYLYFDYTDKENIKHEVWYADQVTLEYLSKVIIEEGYDVSLWRLGGNLFNK

Enzyme Prediction     

No EC number prediction in MGYG000001328_00495.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	69	347	4.1e-20	0.8648648648648649

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06549	GH18_trifunctional	6.26e-36	114	347	61	292	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
cd02874	GH18_CFLE_spore_hydrolase	5.89e-33	61	346	6	303	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	5.49e-19	133	346	178	408	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	2.57e-08	140	235	85	192	Glyco_18 domain.
pfam00704	Glyco_hydro_18	2.78e-08	140	323	82	293	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKN29836.1	1.97e-131	7	350	3	347
AKA69491.1	3.96e-131	7	350	3	347
AWI04411.1	1.13e-130	7	350	3	347
QGH23454.1	6.59e-114	4	350	5	343
QGH27498.1	6.59e-114	4	350	5	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	7.23e-07	135	345	84	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3K_A	9.61e-07	118	346	177	413	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	3.06e-09	78	346	131	409	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O05495	6.96e-07	135	345	176	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.897354	0.097492	0.002700	0.000420	0.000254	0.001797

TMHMM  Annotations     

start	end
10	29