CAZyme Information: MGYG000001328_00873

Basic Information

• Species: Clostridium tertium
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium tertium
• CAZyme ID: MGYG000001328_00873
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	MGYG000001328_3|CGC10	36460.95	4.8582

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001328	3807822	Isolate	not provided	not provided

• Gene Location: Start: 585154; End: 586119 Strand: +

Full Sequence      

MEYKGTYKGISDYKENYIKGGIKKILLTIIFIITFISTLVFMTSKFIKSVSEETLLSNDD
INKYINTCDDASSGGFQLNWQEIAAISGTIKNGNFEIDNNVINKIVNSFYKKDSSGNIIE
LNSFKSAVKSLKLNNEEEETANKYLEGLKNNYIHRELAKDSSKLEFIDNISEIAFDNYKS
YGILPSITIAQAILESGWGESTLSSQYNNLFGIKADERWIGDSVDLQTKENYDDVIVGAF
RSYKDLKSSIKDHGKFLWENERYSANGLFEAKSYKEQAQALENAGYSTAKDEEGNLIYGD
KLIRVIQENNLMLYDTKVQRK

Enzyme Prediction     

No EC number prediction in MGYG000001328_00873.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	172	311	7.8e-36	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	6.70e-50	160	316	40	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	3.47e-28	179	307	168	295	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	6.94e-23	162	317	7	142	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	1.30e-22	166	315	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	9.30e-22	172	253	2	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBJ75012.1	2.59e-97	1	320	1	320
ATD57589.1	2.59e-97	1	320	1	320
SLK15979.1	2.59e-97	1	320	1	320
ATD54730.1	2.59e-97	1	320	1	320
QSW19705.1	3.72e-96	1	320	1	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	2.96e-15	166	315	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
3VWO_A	1.49e-12	166	311	4	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.78e-12	166	311	5	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.17e-11	166	311	5	149	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	3.39e-11	182	312	22	151	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	8.36e-23	156	315	37	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	5.31e-19	158	308	155	304	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	7.92e-17	162	314	160	312	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9I4P4	1.43e-12	165	288	241	370	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P0C2T5	3.00e-11	158	315	57	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999984	0.000032	0.000000	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
20	42