CAZyme Information: MGYG000001328_02871

Basic Information

• Species: Clostridium tertium
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium tertium
• CAZyme ID: MGYG000001328_02871
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233	MGYG000001328_3|CGC40	28115.12	6.7436

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001328	3807822	Isolate	not provided	not provided

• Gene Location: Start: 2690593; End: 2691294 Strand: -

Full Sequence      

MDKIPKVIHYCWFGGNEKSKLINKCMETWKRYLKDYEIMEWNEENFNIDICSFTKEAYED
KKWAFVSDYCRLWVLYNYGGIYLDTDIEILKPLDDLLDNKSFTGVEEEDQIAFGIWGCRR
QDKFLGEILEYYNLINYSEYKGNLQGLAIPIHITNMAKKLGYIKNQDSISYYGDDVVVYP
KDYFYPKRHAWEEPKITKNTYTIHHYEGTWRKPHQILRSKTKELLMNAIRYFR

Enzyme Prediction     

No EC number prediction in MGYG000001328_02871.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	99	1.2e-25	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	6.56e-19	2	130	80	212	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	3.07e-15	23	102	5	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	5.14e-10	3	102	45	149	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	1.28e-04	33	86	145	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam04572	Gb3_synth	0.004	123	204	2	91	Alpha 1,4-glycosyltransferase conserved region. The glycosphingolipids (GSL) form part of eukaryotic cell membranes. They consist of a hydrophilic carbohydrate moiety linked to a hydrophobic ceramide tail embedded within the lipid bilayer of the membrane. Lactosylceramide, Gal1,4Glc1Cer (LacCer), is the common synthetic precursor to the majority of GSL found in vertebrates. Alpha 1.4-glycosyltransferases utilize UDP donors and transfer the sugar to a beta-linked acceptor. This region appears to be confined to higher eukaryotes. No function has been yet assigned to this region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQR93885.1	1.46e-92	1	233	1	232
AGF54961.1	1.19e-91	1	233	1	232
AST58537.1	2.89e-67	2	225	3	224
ADQ45275.1	4.62e-64	4	231	2	223
VEB26993.1	1.25e-62	4	228	2	221

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O14084	2.29e-10	1	102	61	168	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
Q10323	6.88e-06	4	129	57	185	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001328_02871.