CAZyme Information: MGYG000001328_02988

Basic Information

• Species: Clostridium tertium
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium tertium
• CAZyme ID: MGYG000001328_02988
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589	MGYG000001328_3|CGC48	65443.96	4.7465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001328	3807822	Isolate	not provided	not provided

• Gene Location: Start: 2850936; End: 2852705 Strand: -

Full Sequence      

MVNLKVKPYNLDEESIRWVEDTINNMSIEEKIGQLFVNMGASRDEEYLKSILDNYHIGAV
RYNPGKAEEVYEQNRILQENSKIPLLIAANTEMGGNGACTDGTYVGNEVKIAATQDSHYA
YELGRISGIEASAIGCNWSFAPIVDINRNWRNPIISTRTWSADVEQTLELSLQYMKGIME
SGILPAAKHFPGDGIDERDQHLSFAPNTLTVEEWDNTFGKVYSGLIEAGLPSIMAGHIAL
PQYVKKFNPEATIQEMNMPATLSKYVLTDLLKGQMGFNGLVVTDASHMVAMTSAMKRKDM
LPTAIAAGSDLFLFFNDPDEDFQWMMEGYKNGVITEERLNDALSRILGLKASLGLHKKAK
TEILQPKEEAMAKIGLEENKKAALEIADKGITLVKNNQEIFPISADKTKKVLLVNAKGFE
GGFGKFISLMQGVQKGPIDIMKELLVEEGFEVEIYESPIDKIMKLPKEEMGAALGNVYAG
KRPIAELTSKYDLIINIADVGASVDQRLQWPPSKGTPDIPFYVNEIPTIFVSVQCPFHLA
DVPQVKTYINTYDNKDYTLKALVDKMVGRSEFKGVSPVDAFCGLEDTRY

Enzyme Prediction     

No EC number prediction in MGYG000001328_02988.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	313	9.7e-48	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.66e-67	26	443	1	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	8.02e-65	27	349	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	3.36e-21	19	441	38	427	beta-glucosidase BglX.
PRK05337	PRK05337	9.75e-20	118	358	97	308	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMN34377.1	0.0	1	589	1	589
BAB79860.1	0.0	1	589	1	589
AQW22542.1	0.0	1	589	1	589
ALG47535.1	0.0	1	589	1	589
QQA12216.1	0.0	1	589	1	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	1.78e-138	4	588	6	566	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	7.72e-51	23	579	39	616	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.63e-50	23	579	13	590	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.09e-50	23	579	43	620	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	5.12e-42	26	577	11	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	2.08e-137	1	587	1	562	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	4.23e-50	23	579	39	616	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	1.10e-24	73	397	88	420	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q7NWB7	4.70e-20	120	320	103	290	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1
Q56078	7.77e-20	18	412	37	416	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001328_02988.