CAZyme Information: MGYG000001329_00859

Basic Information

• Species: Helicobacter_A rappini
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_A; Helicobacter_A rappini
• CAZyme ID: MGYG000001329_00859
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291		33905.73	7.2328

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001329	2523721	Isolate	not provided	not provided

• Gene Location: Start: 5360; End: 6235 Strand: -

Full Sequence      

MVFAFSPKDILQNENGEEVLSKPKYKIITRGFRYDMLKRVFNGINYAILETTPTTQAQRN
HYNEVNAKVQKLKDMVNELNRLHADNEPMFVHYKLDTRARIEHFFAQSWVETWAGQLRLA
ESISKENANKNYNNRYGNRPNTDDGYNFRGRGLLHLTFRDNYHACTRYLHNQGWLSSDID
FEAQPQLVTDSGVYALLSAVYYWNTKTYPNGVNVSIPAWRNFHLYEIADDEANGNTIIPT
IDEDTQQEIDLTQAQRTISVLVNGGRKGLTSRRDSHNRIRNNQIFVEFDNQ

Enzyme Prediction     

No EC number prediction in MGYG000001329_00859.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	96	210	1.1e-22	0.4675324675324675

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	8.70e-16	93	280	34	201	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	0.003	104	209	52	158	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQQ59189.1	3.02e-195	19	291	1	272
AQQ59183.1	4.61e-120	28	205	13	189
AQQ59187.1	8.84e-59	144	289	5	146
QPH85036.1	7.22e-28	72	288	948	1182
AVX44620.1	1.27e-25	72	288	975	1210

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000015	0.000029	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001329_00859.