CAZyme Information: MGYG000001329_01645

Basic Information

• Species: Helicobacter_A rappini
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_A; Helicobacter_A rappini
• CAZyme ID: MGYG000001329_01645
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505		56461.48	8.1216

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001329	2523721	Isolate	not provided	not provided

• Gene Location: Start: 200857; End: 202374 Strand: +

Full Sequence      

MQNNISTCSSHTNKNSQHNLNAEAANTMRINNKRGGGGESSEIYNQQTGFVLKHDNFVES
GTIRTNTQLKLQGMESDTTLSLQPPKKIAVIIPCYNEEKTIAQVIDEVFAVLPNAHIYVF
DNNSSDNSRNIVKAKIDEIKSLDCHIERSEISNMESKKDFSCLHTRTSGALAHTCKNDKT
AESYNFAPLRPASTHLDKNLDSKNYALNPAAHPNLTQNLDSIKMHPKPCTHTESVENLDS
KIPTKSLTLHSVSTQGKGAVMREAFALIEADFYIMIDADTEHDASILPQALAYFSTHKLD
MLNIAREADSSTYRKGHSFGNKLFSKSTQMLFGTKINDMLSGYRIFSRPFVKSFPAHSNG
FEIETELTIYALEQRLRTDEIKAPYKSRPEGSFSKLSTFKDGFKISLMILNLLFSERPLL
VFGVLSAICFLLSLFFGVPVFVEFLETSKVARFPTLFVCVGLMVIAVVLFIAGLLAHLVT
KSIKESRYLAYLQSKRESYKGIYGE

Enzyme Prediction     

No EC number prediction in MGYG000001329_01645.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04179	DPM_DPG-synthase_like	1.71e-24	90	371	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
COG0463	WcaA	2.46e-10	86	146	3	64	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd00761	Glyco_tranf_GTA_type	4.32e-08	90	147	1	59	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	5.25e-08	90	134	2	47	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04188	DPG_synthase	4.42e-07	90	150	1	66	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOQ91841.1	1.76e-236	87	505	19	427
BAM32560.1	5.43e-235	90	505	1	406
BBB19529.1	1.09e-234	90	505	1	406
QOQ97220.1	8.95e-234	90	505	1	406
BAM11933.1	3.64e-214	119	505	1	377

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37787	1.57e-38	339	495	1	157	Uncharacterized protein SF2094/S2216 OS=Shigella flexneri OX=623 GN=SF2094 PE=4 SV=1
P37786	1.50e-13	88	317	7	128	Protein RfbJ OS=Shigella flexneri OX=623 GN=rfbJ PE=3 SV=2
D4GYG3	4.07e-13	253	423	61	233	Glycosyltransferase AglJ OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
419	441
456	478