CAZyme Information: MGYG000001329_02278

Basic Information

• Species: Helicobacter_A rappini
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_A; Helicobacter_A rappini
• CAZyme ID: MGYG000001329_02278
• CAZy Family: GT11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
279	MGYG000001329_9|CGC6	33124.22	7.9641

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001329	2523721	Isolate	not provided	not provided

• Gene Location: Start: 905456; End: 906295 Strand: +

Full Sequence      

MLYNISLPLCFDYKTLVKYFYSNDKSLKYNFPLQYIRYATRSKYHKLYWLALKHYKYFYD
EDPQGDNIVKMYLNDSLEKHAYPFGYFQNLIYFDDIYSIIREEFCLKIPLKPHNQTLKEK
IEKTENSVFLHVRLGDYLKMEATNGDYVLLGKTYYQSAIEILKTRLGQPHIFIFSNDIEW
CEKNLCNLLDFKGCHIEFVKANGEGNAAEEMELMRACKHAVIANSTFSWWASYLIDNPDK
QIIMPTQVFNDTRRIPKSNMLAKKGYILIDPFWGTHSIV

Enzyme Prediction     

No EC number prediction in MGYG000001329_02278.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	74	261	4e-53	0.6376811594202898

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	4.20e-41	76	258	84	265	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	3.80e-21	82	247	125	278	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQQ58896.1	3.76e-208	1	279	1	279
BAM12957.1	8.02e-83	3	275	55	328
BBB20846.1	2.48e-79	60	275	40	252
QOQ90811.1	4.80e-78	69	275	1	204
QOQ96969.1	4.80e-78	69	275	1	204

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	7.44e-17	84	249	123	286	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q9TTY3	2.44e-12	85	234	172	321	Galactoside 2-alpha-L-fucosyltransferase SEC1 OS=Bos taurus OX=9913 GN=SEC1 PE=1 SV=1
Q10979	8.30e-12	92	234	173	317	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Oryctolagus cuniculus OX=9986 GN=FUT1 PE=2 SV=1
Q866E8	1.47e-11	92	234	174	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Sapajus apella OX=9515 GN=FUT1 PE=3 SV=1
Q29043	1.98e-11	92	234	173	317	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Sus scrofa OX=9823 GN=FUT1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000084	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001329_02278.