CAZyme Information: MGYG000001330_00259

Basic Information

• Species: Helicobacter_D winghamensis
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D winghamensis
• CAZyme ID: MGYG000001330_00259
• CAZy Family: AA4
• CAZyme Description: 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559		63591.81	6.8682

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001330	1654872	Isolate	not provided	not provided

• Gene Location: Start: 15296; End: 16975 Strand: -

Full Sequence      

MILPIDVKENDFLAACKEFEKAIGKEWVFKSEEDLGLYRDAYSPQWDDADEPIPSLALAP
KSTEEVQTIVKIANKYKIPLFPISTGKNLGYGSSAPQRRGDVIVDLKRMNKIIEVDDKRN
FCIVEPGVSYFDLYEYVERNNLNVFLDIPDPGWGSPVGNALDHGWGYSYGMYRDHFGSHC
GMEVVLANGEILRTGMGALPGAKTFAENKYGYGPYVDGLFSQSNFGIVTKMGFWMMPKPE
HYLLLSLTMKHRDDLIPAVEILNYLEDSFIVGWPLYRSPLNPPHGKAMDPELKSYLTSKK
GLPDLNKIQNYALNKNIPYWQIDIPIYGCKDTCYANMNYIKERFKVVKDAEIKVVQEFSL
PLNAEQKTQLKHKVSLGIPNMEIFWLSTRGEATTPSDGHVWFSPIIPRDGKELLKCQDVY
IQVFHDLGMESPITPFAHPRSWMYRAFCFMLAFGNSRTDPEHNLKLRQAYRTMVRVAAEN
GWGDYRAAPTFQDDVMGAYSFNNNALLRFNEQLKDCIDPNGILAPGRGGIYPKNARSQRF
ANSKLDEITLKNLKQGDKK

Enzyme Prediction     

No EC number prediction in MGYG000001330_00259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA4	2	538	3.4e-142	0.9885057471264368

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01565	FAD_binding_4	1.98e-32	54	195	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
COG0277	GlcD	3.53e-29	18	527	1	454	FAD/FMN-containing dehydrogenase [Energy production and conversion].
PLN02805	PLN02805	3.28e-17	53	241	133	310	D-lactate dehydrogenase [cytochrome]
PRK11230	PRK11230	2.59e-07	28	240	34	232	glycolate oxidase subunit GlcD; Provisional
TIGR01676	GLDHase	0.002	46	128	54	132	galactonolactone dehydrogenase. This model represents L-Galactono-gamma-lactone dehydrogenase (EC 1.3.2.3). This enzyme catalyzes the final step in ascorbic acid biosynthesis in higher plants. This protein is homologous to ascorbic acid biosynthesis enzymes of other species: L-gulono-gamma-lactone oxidase in rat and L-galactono-gamma-lactone oxidase in yeast. All three covalently bind the cofactor FAD.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA17285.1	6.21e-105	2	538	50	579
CAP97133.1	1.35e-103	2	538	50	579
QKX53028.1	3.76e-103	2	538	54	587
CDR40370.1	1.58e-102	3	538	46	574
BCS28228.1	3.18e-101	2	538	50	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FXD_A	3.55e-107	3	540	5	526	Crystalstructure of eugenol oxidase in complex with isoeugenol [Rhodococcus jostii RHA1],5FXD_B Crystal structure of eugenol oxidase in complex with isoeugenol [Rhodococcus jostii RHA1],5FXE_A Crystal structure of eugenol oxidase in complex with coniferyl alcohol [Rhodococcus jostii RHA1],5FXE_B Crystal structure of eugenol oxidase in complex with coniferyl alcohol [Rhodococcus jostii RHA1],5FXF_A Crystal structure of eugenol oxidase in complex with benzoate [Rhodococcus jostii RHA1],5FXF_B Crystal structure of eugenol oxidase in complex with benzoate [Rhodococcus jostii RHA1],5FXP_A Crystal structure of eugenol oxidase in complex with vanillin [Rhodococcus jostii RHA1],5FXP_B Crystal structure of eugenol oxidase in complex with vanillin [Rhodococcus jostii RHA1]
1W1K_A	1.09e-97	1	532	10	550	STRUCTUREOF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum],1W1K_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum]
1W1J_A	4.26e-97	1	532	10	550	STRUCTUREOF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: The505Ser Mutant [Penicillium simplicissimum],1W1J_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: The505Ser Mutant [Penicillium simplicissimum]
1W1L_A	5.99e-97	1	532	10	550	STRUCTUREOF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Phe454Tyr Mutant [Penicillium simplicissimum],1W1L_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Phe454Tyr Mutant [Penicillium simplicissimum]
1AHU_A	5.99e-97	1	532	10	550	StructureOf The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With P-Cresol [Penicillium simplicissimum],1AHU_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With P-Cresol [Penicillium simplicissimum],1AHV_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 2-Nitro-P-Cresol [Penicillium simplicissimum],1AHV_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 2-Nitro-P-Cresol [Penicillium simplicissimum],1AHZ_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 4-(1-Heptenyl)phenol [Penicillium simplicissimum],1AHZ_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 4-(1-Heptenyl)phenol [Penicillium simplicissimum],1VAO_A Structure Of The Octameric Flavoenzyme Vanillyl-alcohol Oxidase [Penicillium simplicissimum],1VAO_B Structure Of The Octameric Flavoenzyme Vanillyl-alcohol Oxidase [Penicillium simplicissimum],2VAO_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum],2VAO_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P56216	3.28e-96	1	532	10	550	Vanillyl-alcohol oxidase OS=Penicillium simplicissimum OX=69488 GN=VAOA PE=1 SV=1
P09788	4.43e-92	2	534	8	519	4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida OX=303 GN=pchF PE=1 SV=3
P94535	5.05e-18	37	240	28	218	Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) OX=224308 GN=glcD PE=3 SV=1
D4MUV9	4.96e-15	54	259	48	243	D-lactate dehydrogenase OS=Anaerostipes hadrus OX=649756 GN=CL2_23160 PE=1 SV=1
A4VGK4	8.38e-15	40	259	27	237	D-2-hydroxyglutarate dehydrogenase OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=d2hgdh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001330_00259.