CAZyme Information: MGYG000001330_00389

Basic Information

• Species: Helicobacter_D winghamensis
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D winghamensis
• CAZyme ID: MGYG000001330_00389
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
691	MGYG000001330_19|CGC2	79620.38	9.2783

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001330	1654872	Isolate	not provided	not provided

• Gene Location: Start: 154797; End: 156872 Strand: +

Full Sequence      

MVFYSTSRQLIVNVKNFYCAILYKGCEKIQKNDIFLGWGRKKSGLKAIELAKKNNSSFLL
LEDGFLRSLDLGVENSPSFSLVKDAVGIYYDATSESELERILNTYEFDDRFLTEASLAIK
QIKHERLSKYNNNLSIPKDFFVGDESRILVITQVANDASLKYGLADSFSTLDLIDDAIRE
NPTSRIYIKIHPDVLSGKKTSDIDVNMIPKECVLLKENYNPIELLGYFKKVYTKTSGMGF
EALMMGCECVCYGLPFYAGWGLTQDKLICNRRTKKRILEEVFAASYMLYSEYFNPYLGKK
SDIFDTINTLAKYKKIEQNNSGNLYFLGFTLWKRWFIKPFFKAKNNRFFFLNSLEDLEKY
PLTQVDKFFIWGGKFAKEDLIGVLQNLGVYNSEVYFVEDGFLRSVSLGSDLTRPFSLIVD
SKGLYVDPNLPSDLEGILQNYNFNEGLIERAKSLRDNIVHHKFSKYNGLQHKDLKINTDK
KIILIPAQVEDDASMLLGGMGYTTLLLLQEVREKNPEAFILYKPHPDVSSGNRKGLKDKK
IILKYCDFILENVSIDSAILACDEVHTITSTSGFDALLREKKVFVYGLPFYAGWGLTQDK
HRVTRRTRILKLEELVAGTLIVYPRYIHPKSKSLCEVEIALDIMLKIQRDYFSKIHVRLF
VDFRTFILRKIRRVLEFIIKNGSKKKIKTIF

Enzyme Prediction     

No EC number prediction in MGYG000001330_00389.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	291	656	2.5e-129	0.6804511278195489
GT107	27	311	8.8e-100	0.5319548872180451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	1	678	1	670	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16439	beta_Kdo_transferase_KpsC_2	1.24e-136	366	626	1	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16440	beta_Kdo_transferase_KpsC_1	3.64e-126	35	295	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16439	beta_Kdo_transferase_KpsC_2	7.06e-87	35	292	3	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	3.16e-83	397	626	26	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOQ97702.1	0.0	1	691	1	691
AJC93656.1	0.0	1	679	1	679
QBL13961.1	0.0	1	679	1	679
QEL07869.1	0.0	1	679	1	679
QYH03034.1	0.0	1	679	1	673

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGB_A	1.34e-75	7	310	15	321	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGC_A	1.52e-63	22	343	20	351	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGD_A	1.87e-61	323	627	3	301	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P57037	5.03e-150	24	646	51	673	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
Q05013	1.41e-149	26	646	47	673	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P42217	1.95e-141	22	649	19	646	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
P31858	3.04e-53	381	641	130	396	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001330_00389.