CAZyme Information: MGYG000001330_01285

Basic Information

• Species: Helicobacter_D winghamensis
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D winghamensis
• CAZyme ID: MGYG000001330_01285
• CAZy Family: GT56
• CAZyme Description: TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338		39403.72	8.8629

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001330	1654872	Isolate	not provided	not provided

• Gene Location: Start: 243874; End: 244890 Strand: -

Full Sequence      

MILHILSSATHSVRFVEFMQKYFDLKKHKFVYVRPDICKYGLSNFKEVEHISTLKQQLKL
IYLMQKADKIILHGLWRHEVINLLYFQKWLLKKCYWVLWGGDFCLGKESYSRRHNFVLQN
VGHLISIAGDYEYVKKEYNTKGEVFYSKSFYVSNVFNGELYLSNKDGKLVILIGNSADPL
NLHKDILNALKPYRDSNIELICPLSYGSNKEYQDEIIEYGKNIFGAKFKPLVEFMPLNAY
LDLLSSLDIAIFAHKNQQAYGNIIQLLGMGKKVYMRKTTAYNEVLKNGLKIFDFDSGVDL
CRIDDSAIKNHHLTKNIYSLENMLSEFKELFGVDNEAF

Enzyme Prediction     

No EC number prediction in MGYG000001330_01285.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT56	4	299	4.3e-63	0.8823529411764706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK02797	PRK02797	2.11e-66	64	295	37	276	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase.
pfam07429	Glyco_transf_56	1.01e-14	93	270	105	289	4-alpha-L-fucosyltransferase glycosyl transferase group 56. This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (EC 2.4.1.-) (approximately 360 residues long). This catalyzes the synthesis of Fuc4NAc-ManNAcA-GlcNAc-PP-Und (lipid III) as part of the biosynthetic pathway of enterobacterial common antigen (ECA), a polysaccharide comprised of the trisaccharide repeat unit Fuc4NAc-ManNAcA-GlcNAc.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOQ97873.1	3.23e-248	1	338	1	339
AZV47328.1	1.50e-74	1	331	1	332
QCZ23573.1	1.80e-74	2	332	6	338
AYJ79308.1	1.80e-74	2	332	6	338
QKF68394.1	2.02e-73	2	332	6	338

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5RFR1	4.34e-13	95	267	105	284	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=wecF PE=3 SV=1
B5QVI4	4.34e-13	95	267	105	284	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=wecF PE=3 SV=1
B5FN86	4.34e-13	95	267	105	284	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase OS=Salmonella dublin (strain CT_02021853) OX=439851 GN=wecF PE=3 SV=1
Q9L6Q8	5.85e-13	95	267	105	284	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=wecF PE=3 SV=1
A9MJ17	5.85e-13	95	267	105	284	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) OX=41514 GN=wecF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001330_01285.