CAZyme Information: MGYG000001331_01872

Basic Information

• Species: Oxalobacter formigenes
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Oxalobacter; Oxalobacter formigenes
• CAZyme ID: MGYG000001331_01872
• CAZy Family: GH103
• CAZyme Description: Membrane-bound lytic murein transglycosylase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		42322.28	7.1635

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001331	2417984	Isolate	not provided	not provided

• Gene Location: Start: 2049397; End: 2050527 Strand: +

Full Sequence      

MMIFDSGRKTALMFFISILFPLICFGQVSEKNTSQPESTCSSSPNMPGSVESGEAAIPFT
IEPPLADFIDRFSTKYHVDKNRLNCLFQGTRVNHTAIRLMKPSGSGKTKNWQAYRQRMIE
PVRVNAGVRFWNTYEKYLDRAEKEYGVPAYIIVGILGIETIYGRDTGRFRTLDALTTLAF
YYPETPNKASRQEFFRKELEQFLLLSSQNQVDPLSIYGSYAGAIGWPQFMPGSIRAYAVD
FDKDGKIDLENSAIDAIGSVANFLKQHGWKTGKPVIFPATADVDCPLPETLFNQGLKATY
SLKELNAQCISTDPLAPDNLLYGLVDLPNGPYPTEYRIGTDNFFAITQYNRSYFYAMSVI
ELGKKVLLEKTGRYAE

Enzyme Prediction     

No EC number prediction in MGYG000001331_01872.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	75	365	3.8e-85	0.9457627118644067

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02282	MltB	1.77e-118	66	366	1	290	lytic murein transglycosylase B. This family consists of lytic murein transglycosylases (murein hydrolases) in the family of MltB, which is a membrane-bound lipoprotein in Escherichia coli. The N-terminal lipoprotein modification motif is conserved in about half the members of this family. The term Slt35 describes a naturally occurring soluble fragment of MltB. Members of this family never contain the putative peptidoglycan binding domain described by pfam01471, which is associated with several classes of bacterial cell wall lytic enzymes. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam13406	SLT_2	6.44e-116	62	363	3	291	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
PRK10760	PRK10760	2.44e-93	12	366	2	353	murein hydrolase B; Provisional
COG2951	MltB	9.63e-90	38	366	15	335	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
TIGR02283	MltB_2	1.76e-56	107	359	48	291	lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDX34016.1	3.70e-282	1	376	1	376
ARQ77449.1	3.70e-282	1	376	1	376
ARQ45141.1	3.70e-282	1	376	1	376
AYR23084.1	8.57e-126	49	370	64	383
ALU88003.1	1.32e-125	49	370	77	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O8X_A	2.47e-80	63	366	6	299	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	4.19e-80	63	366	23	316	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
1LTM_A	2.57e-65	59	370	13	318	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]
1D0K_A	2.73e-65	59	370	15	320	ChainA, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0L_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0M_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1QDR_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QDT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUS_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli]
5ANZ_A	4.46e-25	78	359	64	336	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	4.49e-64	59	370	54	359	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.064498	0.871668	0.062522	0.000705	0.000307	0.000286

TMHMM  Annotations     

start	end
12	29