CAZyme Information: MGYG000001332_00509

Basic Information

• Species: Massilioclostridium methylpentosum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium methylpentosum
• CAZyme ID: MGYG000001332_00509
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1268		137808.65	4.0984

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001332	3406391	Isolate	not provided	not provided

• Gene Location: Start: 533115; End: 536921 Strand: -

Full Sequence      

MKIFNKKKALALLLSATMAVTIAGSSISAMAVPASSTEIEYLRVNYMENPLGIDKDDVRF
SWAMDSNLIGQNQKAYQIVVTKDNANGAVVWDSGRVEDDKSVAVRYDGPALELETRYYWT
VSVTDATGTVTKSAPSYFDTGCDFTQADWIVAGRQEAGAPMFRTQKTLSKSVESAKLYIS
SLGIYNAYVNGQEVLAGEVDDTFNPGWTDYFHYVNYQTYDITDYIDDSELAIGVMVGNGW
YAGNIGTVANYQSIGDPDVSELALIAKAVVTYTDGTKEVISTNTTDWKSSDESPVLSNDF
FDGTSYDARIAAQVAGWNDIGYDVSGWDEVAKFDYTGELRPSSKAAASVDETTTHQPIGG
EDCFKYSQIEKPVSEGGTSEYATGHVVKQPVDTTGDMTIQPGETLILDMGQNKAGVMDLT
ASAAAGTTMKIRHAEMLNDGKLNPEIEKGGSDGPKGSIYTVALTSAKVTDQYTFAGTGDE
VFEPDFTFHGFRYVEITADAEVTIKRAESKTITSVTDQTGYLETSDPSVNQLVQNTLWSQ
RSNYLSIPTDCPQRAERVGWTGDAQLFAQTGLYNFDATAFFENYIDVMNQSNSNNGGFYS
AIMPTGFVGFFASMVSCGWSDAGVIIPWTVYQQTGDLTTIEKSYDYMTSYMQRVYEQGYS
SPMFGDWLGLYPASTPYLNAVYEIYCTQLMEKMAGLIGETEDAATYAAKYLELKEKFMEK
YVDENGNVLSATADGGGVSNHGYPYIDNAQTALLWALKCGLYDTQAQKETYVENLVKNIK
NENGAVRPEYGENTLSVGFLGVNVLLPILSEVGEAETAYALLMQDELPSWLYSVKNGATT
IWERWNSYSVDNSFGDAGMNSFNHYSYGACLEWMYQYMVGIKQSATTPGFKEFILQPTVD
TQSQITYANGRYDSNYGEIVSNWTADGNGNLTSYSAVVPANTTATLYLPVNADAVSDFQG
IDGITFLGMTTNNGQQVAAFSLSSGGFDFSIQDGKLSVAAGEGYVTPTQANKTILSQVIA
YAQTQKDSDEFENVIPMVQESFTAALENAKSVNTNLMASQEEVDGAWKALMNEIHKLGFV
KGSKTNLNTLIEVGESYNLDNYVEQGKAEFTAALATAKTVYNDGNAMQDEVDSAASELLN
AMVNLRLRADKSLLEKTLVETEVADLSSYTEQSVDAYNAARAEAEAVFADNNLTESDQDV
VNRAADNLKAAYDALTRLDVGQAATVAGDTALSTSGRNVKTGESSPIAVAVAVAALAATA
FVVSKKRR

Enzyme Prediction     

No EC number prediction in MGYG000001332_00509.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	400	948	2.5e-147	0.9900793650793651
CBM67	147	336	2e-27	0.9659090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.02e-106	517	878	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.13e-48	170	341	1	162	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.34e-26	401	501	4	89	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.60e-14	880	956	1	71	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam07554	FIVAR	1.62e-04	1156	1216	4	69	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYA74416.1	0.0	39	957	35	968
QXE01526.1	1.46e-270	21	1012	23	1197
ACX65306.1	2.10e-234	39	990	7	1005
QEV65837.1	4.46e-226	29	985	40	1028
QKZ16767.1	8.83e-226	22	985	34	1028

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	2.10e-118	44	992	11	1031	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.53e-104	39	949	4	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.14e-95	42	949	35	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	2.63e-123	48	951	45	881	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	1.22e-117	44	951	11	997	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	6.15e-111	49	956	42	886	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	1.73e-78	35	948	28	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000409	0.998631	0.000197	0.000295	0.000222	0.000195

TMHMM  Annotations     

start	end
12	34
1247	1264