CAZyme Information: MGYG000001332_00594

Basic Information

• Species: Massilioclostridium methylpentosum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium methylpentosum
• CAZyme ID: MGYG000001332_00594
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1490		163699.67	4.0565

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001332	3406391	Isolate	not provided	not provided

• Gene Location: Start: 649522; End: 653994 Strand: -

Full Sequence      

MKKRNQVLSLVLALSLAATIGGTSLPVGALEAGSETAIVSMQVNSLDNPIIDDASPVFSW
AMQSNQIGQKQTAYQIIVTDSDDQVVWDSGKVEDSKSQSIPYGENGDVLQAKQDYSWYVN
VWDKDGNVTRSETSTFSMGLMDPTLNAWNGAKWIGADELSLNADTLPVYRISYSMQITSG
SKAGFVYGANDPRLNDWTKNDYMIEGENYVYVELDISGLQDEDPDTPAYLNLYRKGYCPE
DQQQPDGMTQVASLSLDGTYGFMLTEEMADDSLDIDIVGSSCAALLMVNGTPLKIGDGDR
GDYTGSPWDNYTGTGKYAGSIIVNPSEKTHDTPNYPRLNDIGFQTDDSTTAVFSDLEVKA
YTAHYGENAVLFGEDTGASYQIFEGLPGVDVDENTISIDRDTLQYADPTYGSIPMLRKDF
TAEKEVASAKLYVTARGIYEMYLNGERIGNDWFNPGYTQYDATQQYNVYDVTEQIGQNNT
IGAVLAAGWWSDQMTFSVNNHSFWGDKQSLLANLEITYTDGSTQQVVSDESWQYYGDGPI
TYSASFDGERYDATKEEAVQGWCTSDYDAYDWRNAVEVPADDWYADPDLVVMTDVPVRQV
ETLQPQDHFEGNPNNSYFIQPYENEDIYVYDMGVNMVGVPEITLPEMPAGSVVMIRYAEI
MYPELAQDNPYNYGDLAGKILTENYRAAYNTDFYTCKGTPGGEVIKPRFTFHGYRFIEIR
GTNGPLPQESIQGIVLSSIEGSTIEYDTSNELTNQLSRNILRSLSGNHVSIPTDCPQRNE
RMGWTGDAAVFCRTATYYGDMNSLYRTWENTMRDVQNKGSGSYNNSPALDQTPSDGNNYD
ASKVSAGVAWPSAGILPVWECYQQYGDLKIVQEHMDSMIRFLDGVCSPRNLQNGCSYLTN
GSGLAEHLALISTDSNYFMNCITKYLLEAVADMAQAVGRDEKAAEYRERAENMKAEFNDK
CIDPETKKPRTVSGVIQDTEAAYAIAIQYGMVNDEYLEDFSQNYVNVCAQGYNNIPFTIS
TGFYGTGKVLPALTKTGKIQEAYAMFEQTEYASWLYPVVNGATSIWERWNGYTIENGFSG
NNGMNSFNHYSAGACGEWMVNYQIGIMNDEENPGFQHFILQPTPGGSFTYVNGAYTSVYG
RIESNWTAEDGVLTSYETVVPANTSATLYLPVQAQYLDRFKNIDGVTYRGMTLHNGQTTA
KFELQSGGYQFRFADGTLCVSHSEGYEGASSADKTILRSVLAYAETVFASDEFDNVISSV
QTSFTAALEQARAVDADLEANQRAVDAAWQALMTEIHKLGFVRGDKSSLGELIALAETFQ
SQLDRYTPVTAEPFTAALSEAKSVYSDGDAMQGDVTAAESSLLEAMLNLRFKADKSILES
MLAKASVIDTTAYTSQSVAAFDAAIGEAKSVFENENATQEEVDSAADKLSAAIDSLVTCA
SAPAGHTVQGDKALSTGSGNAKTGDSTPAAVAFALLMLLGSGYLLGKKKR

Enzyme Prediction     

No EC number prediction in MGYG000001332_00594.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	625	1170	1.9e-134	0.9880952380952381
CBM67	411	578	1.3e-29	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.34e-81	740	1102	2	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	8.36e-50	424	601	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.28e-23	624	737	4	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	8.65e-19	1113	1177	7	70	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam07554	FIVAR	3.97e-06	1378	1437	3	69	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH33563.1	3.44e-315	14	1211	18	1182
QGH37059.1	4.56e-253	31	1212	25	1181
AHF25035.1	1.04e-247	30	1220	15	1233
AIF65800.1	2.57e-244	38	1211	25	1159
SDR84497.1	1.08e-241	2	1211	10	1195

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	3.29e-113	34	1211	2	1028	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	3.32e-88	409	1211	172	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	2.65e-84	392	1171	113	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.39e-112	34	1211	2	1028	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.08e-100	416	1212	177	921	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	5.07e-94	393	1171	157	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	7.09e-52	417	1201	188	929	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000301	0.998923	0.000165	0.000224	0.000173	0.000156

TMHMM  Annotations     

start	end
7	29
1469	1486