CAZyme Information: MGYG000001332_00794

Basic Information

• Species: Massilioclostridium methylpentosum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium methylpentosum
• CAZyme ID: MGYG000001332_00794
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1526		164932.81	4.0106

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001332	3406391	Isolate	not provided	not provided

• Gene Location: Start: 928571; End: 933151 Strand: -

Full Sequence      

MKSKFIMKLAAVCVSATMFATMMVPSVSAIANTSITSAYSSATEILNLKTNNYTIPLTVE
DANPVFSWEMDSNLIGQQQKAYQIVVTRESDGKVVWDSGKVEESKSNDISYQGEALTAET
AYSWDLIVWDAFGQSYTRETRFETGLMDPTLDAWDGAQFVGTNELTLDAASAMLYAIQAD
VEILSGTKASLVFGADDYRLNNQFQNVWNAEGENYVRVEIDVTNVSDNGGAVLNLYKQGY
GTNDAEEVLQRSVNIPANVINSENQYGPHTIRISVETGSITVNIDGTNVGSRLSVSSLST
GNNFNTYPNLASVGFAADAGEEIEVTNYQILSTGRTDADNNVVFGQNTGATYSIFRGLDG
VTVTNNGNRIRVLGGADGVLSYADPSYGSLNMVRNTFTTDTSKKVVGAKMYVTAMGIYEM
YINGERMMAENADGEKVADWFNPADSQYRDTLCYHAYDVTDMISDGENAMGAILGGGWYT
GYQTFTPSNLNFFGNTEALLAKLVITYDDGTTGTVVTNPETWEMFNDGPIEFSGFFQGER
YNANKEAAISVDGNVNGWATTAYDSSAWTQCENVEPREWIDFDIVGRYETPIREYERLDT
TRILNTHSEDNTTYTYDMGVAMVGVPSVTIPAGSLKEGDTVIFRYGEDIYPGNEDSQNTN
EYYTGLYGPEGTFRKGVAGRVLHDTYRAALATDFYTASKEDETRDVVIEPSFTFRGYRYV
QITVPSRTEALPAENVKGVVISSIDQLDGTYNATTTDDTLTGYVNQLFKNIQRSQLGNFM
SIPTDCPQRNERMGWTGDAQAFSRTSTYNADTLNFFRQWMVALRNDQGGNGSIGSTVPEF
STSDPKENTTSFADGTTWAAAICMVPWQMYTQFGDTVIVEENMDAMKLWLDGMDSYDFDE
EHTYLSSRTSGLADWLSVDGKTSSDIVNNAIYIYMMEVTAEMARAIGRTDIADELQTRHD
LAKAEWNDVYFDAELGMTTDRNGNVMDSQASYATPLNFNCFSDENKEVAAARLAVIAADP
NQSGGGAGVIAGSSGPGGGGGNKVDCPAYSITTGFSGTPNILPALTRNGYIDEAYNMFTC
TDYASWLYSVKMGATTMWERWNSYELAFQDNGNSSMNSFNHFALGSVGSWLYEYQLGITT
DHANGAAGYQDFVLQPLAGGNFTALEGSYESNYGTIESSWTADAGTITSYSATVPANTSA
TLYLPADASVVENFENITGVTYTGMTTRNGVSVATFRLASGSYDFAVADGTLTASVADDY
VVAAEADKSILNDVIAYAEAQKADASYESVIPMVKETFEAALAEAKAVAADALATDDAVF
DAWVTLMGEIHKLGFVQGDKTSLAKLISAAGTIEANLDNYIEAGKAEFVSALAAARSVYA
DENALQSEVDPAATALLDAMVTLRLKADKSLLEQTMTIAASIDITAYTDETIAAFNAASD
NANAVYANEAATQDEVDKAQQDLQAAIDGLKAVETAAETGVSVAGDKTVTTGSGNTKTGE
SQAAAMAMTTLVLAAAAFALSKKKKR

Enzyme Prediction     

No EC number prediction in MGYG000001332_00794.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	610	1204	1.8e-132	0.9900793650793651
CBM67	390	576	8.3e-20	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.79e-89	764	1134	13	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.68e-38	403	568	1	147	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	4.98e-15	1145	1208	5	67	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.14e-12	612	742	6	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam07554	FIVAR	1.37e-05	1409	1470	4	68	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF25035.1	0.0	38	1249	16	1228
QGH33563.1	1.94e-240	40	1245	37	1182
AOZ98905.1	2.29e-220	44	1245	24	1177
QGH37059.1	3.42e-215	45	1245	32	1180
QOG04730.1	1.03e-213	37	1243	33	1191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	7.35e-94	56	1247	17	1030	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	7.09e-74	394	1205	135	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.99e-63	392	1245	178	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	3.26e-93	56	1247	17	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	5.08e-92	377	1216	161	895	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	5.31e-83	375	1211	152	885	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	1.97e-43	402	1204	194	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000358	0.998854	0.000186	0.000230	0.000185	0.000165

TMHMM  Annotations     

start	end
9	31
1503	1520