CAZyme Information: MGYG000001332_01052

Basic Information

• Species: Massilioclostridium methylpentosum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium methylpentosum
• CAZyme ID: MGYG000001332_01052
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1756		193063.16	4.2099

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001332	3406391	Isolate	not provided	not provided

• Gene Location: Start: 1253805; End: 1259075 Strand: -

Full Sequence      

MNKKWIRVVGVALSMALMLSSVATAAPAGFAAELPALHIAEMEVNSLTAPMGIDQNPTFS
WGLDTSENGRSQSAYRLVVSSTPEQAANGEGDIWDTGKTAWENNFDIPYAGPALQSKTPY
YWSVQVWDDQDRKSGWSEVSSFETGMLSQSDWVGEWIGDSLASDTVGMKVDGCNWIWSRY
GAPLDQTPEGHQYFRKTFSIDPARTVSKVVFGYTVDDKGKFYLNGELVGESETWQSGAAF
DITDRVVAGENTIALDGHNTSLGYGGLIGRLRIEYADGESAEIITDGSWKLTSAPGNGWE
QPGFDDSSWETPDQILPYGSAPWGTQVNISTTVTEVTSAPLLRKEFEVKGEVASARAYVC
GLGLFDLKINGENPDDTVLNPAHTQYNKSVFYRVFDVAPLLKAGDNAIGVELGKSFYNET
VSTWNWQNAAWRDNPKLLMQLEIRYADGTTETVATGTDWKVASDGPTVFDSIYYGETYDA
RQEKVGFDQPGYSEDESWHDAVVVSAPTGKLKFQQMEPMRRIQAFNPEVTKLANGSYIIT
NPEMTTGWMKLTLDAPAGTEVTITYGERLHADGTLQKQGNDSWFYRTIQQDKYICKGEPG
ESFEPRFSYKGYKYIQIDGYPGELTADQVVCYAIHNEVGKGGSFSSSNEQINALHEIMAR
TILNNFQGKPTDTPVWEKNGWTGDANVSTETMAYNFDIRSFMAKFLEDLEDCQTDSGIIP
NIAPTADWGVENTPVWNTIYILATQQLVNQYGMETFSASQYDSMRKLMTLTISEIQRNGW
VWGDGQLADWVAPSGGTDPNVGGNATASEGSGICGTGYVYEALKAMADIADRLGKADDAA
QYRAAMEQIYTAFNAKFYKPEEQIYQTTHWANPGERTRFRQTSQLVPLAFGLVPEEYKQG
VLDNLVKDIEQKGYHLDTGMVGTKLLLPVLSDNGYADVAYRVLTQTTYPSWGYWLEQGAT
STWEGYENTARSENHYFLGTYDEWLFKGLAGIRDFEDGAKAFVIHPQLTGGLEWVSAKTM
TARGEVSSSWKLQDNGTALFEVTVPVGATAQLILPTSRPDQIFTSDGVAVSTALPGVTAV
EAVGESTSVTIGSGRYSFVSATDGVERYTAELQSAVDYAGTLAQEDYELQAWDLFAAALS
SAKETLANGSQIEINRAVADLEAAVEQLKQYPNQARIDLKALLEEYSTLQREDYFGDYWD
TFAYYYNEAQSQVKDLSISEDMLRQSYDLLEMAAGALAYYRSGNIALGGKVSASSTVNAS
NGWHIDYLTDGDRINLSSAGEYCGWTSNNDINQNHQEWVSVDLGIRSRFDTLTVYPSVYR
EDSPGYGMPVDFDIQVSNDGVNWQTVHSERDYPLPDYGPQTFTFESCYAQYVRLYAYSLR
PKVTDNNLYRMQLTELELYTTPVEQATLGSLTLSAGELNPAFDPAVRSYSVTVPNEVYEL
KVEGTVNGDGTFMITCDPSIDYNPENSTVILKEGETRLRIDVMTDGSRQMQYTDLVIIRE
PGETPDVADKSILRRVIEYARGVLGTVEFDQAISSVQQNFHRALGNAVSADEDSNATQDK
VDAAWIRLMNAIHQLGFKRGDTAQLSFLIEQAQALDLGNYVAAGQEEFTGALTAAREMLT
NEDAMQQDVDEAVSRLLDAMLALRYKADKSLLFSALSRAALVDTAAYTPESVEAFHSAFA
DARTAAKDEALSVDDQAAVDYAAAALGEAIDALVPIAGEQQAAASTGAPKTGDTAAIPAV
FLALVLAGFALGKKKK

Enzyme Prediction     

No EC number prediction in MGYG000001332_01052.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	529	1054	7.9e-143	0.998015873015873
CBM67	174	323	1e-34	0.9886363636363636
CBM67	337	508	4.8e-33	0.8977272727272727
CBM32	1252	1396	2.6e-17	0.9354838709677419

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.92e-90	642	989	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	9.23e-60	350	523	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.73e-21	530	635	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.76e-13	991	1060	1	69	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.32e-12	221	309	18	147	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI59736.1	0.0	3	1402	2	1409
QYJ14959.1	1.24e-257	50	1099	50	1080
AQS56111.1	2.89e-252	79	1098	1	1014
SDU74751.1	8.51e-242	57	1100	67	1088
QFZ72212.1	3.63e-230	37	1057	36	1034

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	2.10e-162	34	1118	1	1038	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	1.99e-131	41	1055	34	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	2.63e-84	303	1068	89	860	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
2OKX_A	2.61e-14	547	1055	449	942	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.14e-161	34	1098	1	1028	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	3.08e-105	50	1062	47	886	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	4.15e-100	44	1099	37	948	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	8.49e-83	50	1055	43	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	1.37e-12	612	1054	700	1136	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000321	0.998914	0.000199	0.000192	0.000172	0.000171

TMHMM  Annotations     

start	end
5	27
1735	1752