CAZyme Information: MGYG000001332_01065

Basic Information

• Species: Massilioclostridium methylpentosum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium methylpentosum
• CAZyme ID: MGYG000001332_01065
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1462	MGYG000001332_11|CGC5	159164.77	4.008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001332	3406391	Isolate	not provided	not provided

• Gene Location: Start: 1278633; End: 1283021 Strand: +

Full Sequence      

MKTSAKAKIISVVLSIAMIASVATQAFAAVPSGTAASTAIVSLKTNNHVDPLNVDDTTPT
FSWQMQSNVIGAMQSAYQIVVTDPNGSTVWDSGKQYDSASAAVEYAGDALSPTTTYSWTV
TVWDTAGNSYTSEPASFETGFMDTTIDAWDGAQWIGTQERNLDATSLYIFNMGYKLRLVP
ETTKASFIFGADDFRLTNKYLSELLTGTENYIRVELDITDMTEEGGAKLNIYRPGYSQTN
ADPDVPYLTISAESGSNIDEILTYANRYDTHSFDFTVNASSISLKIDGTQLQLSGGSRPT
TSFKVKDGETGNNYNTYPDLNQIGFQADPGQVAVFSDLYVANFDLWASDKVGARLFDSET
GATYSIFDGIKGVSHTGNELFINGGLTGVFGYADPSYGSVPMLRTEINASKEIADARLFV
TAHGIYEMYINGERVGEDYFNPGVSEYEKNLRYTAYDVTSMLNQGVNAVGALLGPGWWSD
SMSYTPDNYNYYGDQQALLAKIVVKYTDGTSDTFVTNPDTWTTSNESPIRYSSFFQGERY
DATMEAAVEGWNTAGFDASDWVNASVIETREKFANAALTGDENDPGRVAEVVDSTYVGES
KEGSGSYIYDMGTNMLGIPQITIPEGYASEGQEVIIRYAEVFYPELDEYVEQGVDGLLMV
ENYRAALSTDFYTCKDGAQTIQPTFTYHGYRYLEITGLDKPLPAECVKSLSLSSIEEMTG
SYNSSNELVNQLFKNVQRSQYSNFLSLPTDCPQRNERMGWLGDAQVFARTASYNADVSNI
YQSFLDIIRDDQTEEGHISVYAPSYGGSGFWSGTSWQSAIAIIPYQMYMQTGNTDIIREN
IDAMYSYLGYLAAAPLSEAAPHLTSRAGFLADWLSIDSTDSNLINNAVYVYTMDIFVQMA
NVIGDERAAELAERYEAAKAEWNALYIDPETGRTTDHTQASYATPLMYGVINDEYVEKAA
ANLVDTVENPQNPEVKPYTITTGFSGTPFIVPSLTNYGYVDDAYKMLEQTEYASWLYPVT
QGATSIWERWNSYTLEGGFNGNNSMNSFNHYSLGAIAEWMYGYQLGITNAEGVAAYKEFV
LQPTVGGSFTFANGSFDSKYGTIESGWTAADGAMDSYSATVPANTTATLYLPVSEEATAN
FADVDGITYLGRTTHNNQSVAAFKLVAGEYSFNLVDGKLVASVADGYVSGPDIGKDILRK
TIAYAQEQKADPSFENVIPMVQESFNAALENAIAVEANPAADKDMVYNAWTTLMNEIHKL
GFVKGDKTNLEKLILAGDGILVDIDNYIEDGKQEFTDALAAAKVVFNDPNALEGEVTEAS
DRLLDAMVNLRLKADKSLLGKTIEVANSIDTAVYTLESVNVFNTAKAEAEAIYNDDAYDR
DQEAINAATNKLQNAIDGLVPIDSSTDLDANTSTPDVPVQGDATATTGTSTPKTGETAPA
AIAVAMLALAGAAAVLGKKNRK

Enzyme Prediction     

No EC number prediction in MGYG000001332_01065.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	601	1131	2.8e-147	0.9940476190476191
CBM67	397	568	2.7e-31	0.8863636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.25e-102	717	1063	1	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.49e-49	411	568	1	154	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	4.13e-20	601	703	2	93	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.04e-18	1071	1140	4	72	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam07554	FIVAR	0.006	1354	1400	22	69	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH33563.1	7.65e-306	37	1193	39	1210
AHF25035.1	4.01e-280	36	1179	19	1231
QGH37059.1	2.10e-275	40	1175	32	1183
AOZ98905.1	3.42e-269	27	1175	11	1180
AIF65800.1	2.63e-262	40	1175	25	1162

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.65e-134	51	1183	17	1036	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	4.46e-96	404	1132	135	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.41e-91	401	1172	177	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	9.26e-134	51	1132	17	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	8.12e-114	388	1132	162	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.35e-109	393	1175	168	911	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.55e-62	404	1158	188	925	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KM26	1.24e-07	690	1032	700	1048	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000320	0.998876	0.000177	0.000235	0.000189	0.000166

TMHMM  Annotations     

start	end
7	29
1438	1457