CAZyme Information: MGYG000001332_01311

Basic Information

• Species: Massilioclostridium methylpentosum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium methylpentosum
• CAZyme ID: MGYG000001332_01311
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1673	MGYG000001332_12|CGC1	184957.18	4.2677

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001332	3406391	Isolate	not provided	not provided

• Gene Location: Start: 61713; End: 66734 Strand: +

Full Sequence      

MKQKRMNFSRMGKTLVAALLSAALLLPTVGTAVQASDILSSQTETVQVIRPYITGMETVG
TELKGMYTYYDVNGRPEAGSSFRWLRCDTKLGVYTEIPGATGSNYTLTPEDAGKYIRFEV
TPRTSDEAGSAQQSWMIGPVLTAEQYERIDNRFDNDNDFMANVNSIQSDIASRLANAVYF
TVDSEGLHGSEVFYKNNVQGDFDPSTKPVVQDGTVYAPAAFFTLLLDAEAPDVEATTIDG
ATYYNLKQAAAVLDKQMWSGDEQQSEIANFQMEHLGQGLIVLSDTEAIFDPVTDRDLIDE
ACNMLYTLRATEEQMQWFRDAKYGMFLHWDPSSQIGVEISWDRKAFRPADIGSSYYNAID
PEYDTLGQTFNPTEYNPDEWMQLAKEAGMKYVVLTTKHHASYSNFFSDYDNHTIKETPYN
QDIVEKYVAAAKKAGLKVGFYYSARDWYNPNYLTADHHRYLEYYFGQIQELMTNYGDIDV
MWFDSIGTSSLNQWDPRTLLRRMKQINPDVIVNNRYTAVLAGYDKSPYDVNGDWYTPEHR
LGGFDSSRPWESCMTVTEAPGGGWSYRPNGRVKSVEESVKYLINNVVNDGNLLYNIGPMP
NGKLNETHADVFRQVGKWLEPYKEAIYNTRGGPYQNPQWGGSTYRTDENGLETIYLHVTP
LLKGYTPSGNSLQIDAPGNGQTYSSASLVKDGKEVQLTYNEDGILLTLPEGESWDAYDTV
IRLTPDIAATLASKISQAQSYADSLTSELLATVRQIVENQVAEAKQVLDSGETSRYTEQL
GLLNNCVQYARSAEALADAVVSAEQKMESVAVGTNPWECPQYLYDSLQNNISAAKSLLDA
ADSTAAQFDKSASALNTAVESLNDLMNSLVITFTPDQGRVDNGTTFSMSQSWQELNIRYT
LDGSEPDVSSAIYQGEQLTIPAGIMTVKAALFDANGKKVGATCKHTYLNTENVQNLSPLA
SSVQASSIYSESYTGAKACDGNMNTRWATPDGTITATLELQFDSPQTVNTAQIQEYLDSG
ETTRISKFAIEYWQDGGWKQAYTGDKVGANKVFSFAEFTSDRVRLNIESCMNVTIWEFSL
FQLEDSVGVTADKTNLRPNETAQLAVSGQLADGKPITPEMIEDVTYHTDRDDLVSIDETG
KLRIKEFSDEISFAVWADVTFNGKTVTTEKLSFKASVLGENLALGKTASASSVYGGGFEA
PKAVDGNDRTRWASKVSSSYWFEVDFGKEEQVNNIAFQVYSDRSDPVNYEVYTDFKIQYL
KDGTWMDAYDSSSMTHQITYPVYNGTESYNNVWIDSSGTVKSTDYLVSFDTVTASKIRLF
SDNTKKDPSIIEFGAYYVPEQAIVDKSGLDAAIQQAAEYEGKESEYTADSWAALCTALET
ANTVFDDPDADQETVDAAATALQEAIDGLVKREPVETNKTILKKVLDYAVQAKAGEEYAN
VIASVKASFDAALLAADRVYQDAAASQAEVDRAWMDLLSEIHKLGFQAGDKTQLELLLSY
AKTIDLTNYVQQGQAEYTAALAAAQVCFEDGDALTNEVNLAAQQLLDAMMNLRLKADKSI
LEELLVRSGRIDTTLYSAETIDSFLQAKKEAERVFADSESTQQAVDSAADNLERALERLL
PLEAPAIQGHQGNSTSANGSPKTGDPFSVACILLLAASGSVLLKKKQRPDSNK

Enzyme Prediction     

No EC number prediction in MGYG000001332_01311.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	308	628	3.3e-90	0.8988439306358381
CBM32	1187	1321	7.8e-16	0.8145161290322581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	3.38e-80	315	677	20	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	4.29e-78	315	624	19	333	Alpha-L-fucosidase.
COG3669	AfuC	1.59e-27	354	630	33	323	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	3.05e-12	1187	1271	1	83	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam00754	F5_F8_type_C	1.48e-09	962	1076	1	121	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP43961.1	1.27e-217	45	723	17	699
QWP00755.1	1.27e-217	45	723	17	699
QHV13030.1	7.18e-217	45	723	28	710
QHV15492.1	7.18e-217	45	723	28	710
QHV69491.1	1.01e-216	45	723	28	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GN6_A	2.62e-62	307	724	23	442	Alpha-L-fucosidaseisoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_B Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_C Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_D Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_E Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_F Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus]
4JL2_A	5.23e-42	309	701	13	415	Crystalstructure of a bacterial fucosidase with a monovalent iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482],4JL2_B Crystal structure of a bacterial fucosidase with a monovalent iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482]
4PCS_A	5.64e-42	309	701	13	415	Crystalstructure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCS_B Crystal structure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCS_C Crystal structure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCS_D Crystal structure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_A Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_B Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_C Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_D Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482]
2WVS_A	6.12e-42	309	701	17	419	Crystalstructure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_B Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_C Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_D Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482]
2WVT_A	6.12e-42	309	701	17	419	Crystalstructure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor [Bacteroides thetaiotaomicron VPI-5482],2WVT_B Crystal structure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor [Bacteroides thetaiotaomicron VPI-5482],2WVU_A Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_B Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_C Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_D Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5RFI5	2.14e-34	317	710	47	445	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
Q9BTY2	1.32e-33	317	710	49	447	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
Q6AYS4	5.10e-33	317	709	41	438	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
Q99LJ1	3.63e-32	317	710	38	432	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1
Q99KR8	1.37e-31	317	655	43	390	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000335	0.998861	0.000209	0.000209	0.000184	0.000164

TMHMM  Annotations     

start	end
13	35