CAZyme Information: MGYG000001332_01941

Basic Information

• Species: Massilioclostridium methylpentosum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium methylpentosum
• CAZyme ID: MGYG000001332_01941
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471		53797.48	5.8716

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001332	3406391	Isolate	not provided	not provided

• Gene Location: Start: 252745; End: 254160 Strand: +

Full Sequence      

MRVLFATSEARPFAASGGLADVAGSLPKAIRQKEVACRVVMPLYGDISDEWRSKMTYLCN
FKVSVGWRMQYCGIFECNLNGVIFYFIDNEYYFKRPGLYGFYDDAERFAFFSRAVLEMIW
HIDFVPDILHCNDWQTALVPVYHDLFYRYNERFAQMKTVFTIHNIQYQGKYGFELMEEVL
GIPKYATELMRYDDCLNLVKAAVEVSTRVTTVSPSYAQEIQDPWYAHGLDRELRNHVGKL
TGILNGIDYETNNPETDGQIYKTFSAGDLAGKQANKQGLMNEVGLPMSDEPLVGIVSRLV
DHKGFDLVKYGFEKLVNDGFKFVVLGSGDYIYESFFNEMHARYPERVSTTIGFLPPLSKK
IYAGADMFLMPSKSEPCGLAQMIALRYGAIPIVRETGGLRDSIHDCSLGQGNGFTFRGYD
AGQMMDALYRAKNVYYDKQAWASLVKYGMSCDFSWNVSAERYVQMYNEILR

Enzyme Prediction     

EC	2.4.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	467	3.2e-173	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	466	1	472	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	1	471	1	465	glycogen synthase GlgA.
TIGR02095	glgA	0.0	1	469	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	1.25e-175	1	471	1	480	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14098	PRK14098	1.16e-112	2	470	7	487	starch synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO05864.1	1.70e-212	1	469	1	469
QNO18264.1	1.86e-210	1	471	1	473
ADU20805.1	7.95e-206	1	469	1	469
ARP51332.1	2.71e-205	1	471	1	473
QKN23272.1	2.71e-205	1	471	1	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2QZS_A	4.07e-84	1	466	1	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
6GNE_A	1.06e-83	3	466	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3COP_A	3.17e-83	1	466	1	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
3D1J_A	5.05e-83	1	466	1	473	ChainA, Glycogen synthase [Escherichia coli]
1RZU_A	1.58e-75	1	470	1	476	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0PY73	8.05e-155	1	470	1	476	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1
A4IS20	2.26e-153	1	471	1	476	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
O08328	9.10e-153	1	471	1	476	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1
B9MPC0	1.65e-151	1	470	1	476	Glycogen synthase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) OX=521460 GN=glgA PE=3 SV=1
A4XHL5	9.13e-151	1	471	1	477	Glycogen synthase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) OX=351627 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999903	0.000157	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001332_01941.