CAZyme Information: MGYG000001332_02749

Basic Information

• Species: Massilioclostridium methylpentosum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium methylpentosum
• CAZyme ID: MGYG000001332_02749
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1796		195994.7	4.194

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001332	3406391	Isolate	not provided	not provided

• Gene Location: Start: 606106; End: 611496 Strand: +

Full Sequence      

MKKILSGLVAATLVFSSILSSGILVSAQTGNRAPLAPSNLKTELLEQAYGINTKDPSFSW
VVNDPDQNEEQTAYRIVFANTLADVESGTYLHDTGWTESSENTYVKVEGLSALLSDNDLC
YWQVQTKDKDGKESPLSEPQAFTTAVGSEWASINGIWAGKSDVDPYADWTDYRFEADVTV
KENALGLIFHSTDNTHNYMWQFNAVQNKLNPHIMNGSWSQITSVDLAQSGVKIAVNSTFR
VRIDIVDGTAKTYVDTTVTGDAYTLVDTRAADKYGRGIIGFRTGGSETGSVDNLRVVKLS
ADGTEGDSLYENDFSNATTEFSGCSVQNGALNVPKGQGNGSILKLGGESKVEKGNFVFLR
DEFNVENLGNVEKAVLSVTAKSPEKTRQYVFNMYMNGEFVGLGPARYGTNTLYYNTYDVT
SLLREGANALGAINYTQDEKSFLSQLTLYYKDGSSAVVSNSGRDKDGWKSLDGTDIFGDD
GYSIGTSYFNANAENINANLFPYGWDEPGFDETGWNAVEDKGAIVDSFSLTPYDADNVDR
YLYDSAVVENKGDGVYWIDLGKEIVGGLHLDVDSPVSQQMTLYYGEEGNREAGTVQWQMN
TGNKYREYWTLKEGQQTIENIGMKTFRYVRIENCPVELTTENVKGLAMHQEFSEDESSFT
SSNEMLNEIYDMMKYTIKATNQDLMVDSQSRERGAYEGDALINMLSSYAFEDDYTLSRFS
FEYLNTHSTWPAEYVLFSVEMQWYDYLYTGNIDSLRENYEILKGKLFSQYYDEKMGLMGK
PNLAYLVDWPSSERDGYMFNEAHYNTVFNAVAVGAYSDMAKIAQALGNEEDAAFYQTRSN
TIKENMISKLYNAEKGAFRDGLTSDGTPIDHYAQHATAFPLSYNVFSDTEMAESLAGYIK
SQGKIRMSVYGSFFLLRGLYNAEAGDVANALMADTDASQGQRTWAYMIRTLGATISTEAW
NEANKSNMTYSHPWGSAPGSQIPQGMFGIQPTTPGFDTFQVKFQPGDVENASIKIPSLKG
SIEASFNQNTTSNFMETSVTIPVNTKAEVFLPAASSGHDYLIVDGESVEAVRDGNYLKVE
LGSGVHTVSLPIAAKLTASVETSSPLFVGEEGKLILNAVDANGESVSFDGAQISYSSSDE
TVATVAEDGTISYLAEGNATLKADVVFPSLTIGGQVIHNVAVTATADITIQQPKITEVYI
KLGIDDTNGELHVGDTTKASLMATLESGKQFEISNVDFTVSDDSVVTVDENGTITGVTGL
KEALLTATTSDYLADLVSTFDISRFELLTFYMDGFDGGNSTFPGLPHQDGKLFVDKGKKV
MYDGGKEWTDYTITAKFTVVSNAANITFRAQDANNFYLWQFRSDNKTLKTHVFKNGYSGG
FKLLAEIPIPNINTTGENEVMIAVEGNRFMTYLNGALVDITYDNDLATGSVGVRNGSSES
FLLDDLAISDRTLVTEREISVAEATDKTILNKVIAYAQSAIDNGEVDVLIPSVKQTFMDA
FDHATAVAGRSEATQKQIDQAWAGLLTEIHKLGFVAGDKTELQELYDMASALDLNLYEDG
AAKDAFIAALQAAKAVLDDPDALEGEITSAYETLLNAVDALVKLDKTALLSTIAQADVIN
GQLDKYVSTDAFTAAYAKAIEVRDAEKTTQAEIDAAQEALLNAMLELRYKPDKTILGNLL
AQAASIDLSAYTAESVEAYNAVVAAAQAVYDDESPELKQSDVDNAVQQLKEAQSLLVAKD
GAAISDSTVNGDQNAQTGLQSVKTGEQNKPILYVIIVLVAAAVIAVVLLLVKKFKK

Enzyme Prediction     

No EC number prediction in MGYG000001332_02749.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	550	1051	6.1e-97	0.9940476190476191
CBM67	352	524	1.6e-22	0.9034090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.44e-31	654	979	1	333	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.75e-18	381	519	1	151	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	2.10e-09	988	1069	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.48e-07	552	649	4	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam01204	Trehalase	0.007	809	888	308	386	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYJ03013.1	2.85e-205	10	1089	9	1053
AQW20897.1	3.64e-200	11	1089	7	872
AZM50481.1	3.39e-178	34	1089	28	1036
AKH86459.1	1.76e-177	34	1096	28	1043
AVV47054.1	5.19e-161	21	1089	2	1037

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	7.02e-23	359	1096	305	1036	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	6.06e-21	414	1086	184	861	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
2OKX_A	2.66e-16	548	1057	431	947	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
6I60_A	5.31e-09	36	149	31	142	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	1.28e-68	549	1092	601	1171	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
Q82PP4	7.56e-21	359	1086	305	1026	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
E8MGH9	6.10e-10	1538	1732	1667	1871	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1
T2KPL4	7.53e-07	51	156	46	152	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000264	0.999089	0.000167	0.000174	0.000155	0.000143

TMHMM  Annotations     

start	end
5	27
1772	1791