CAZyme Information: MGYG000001332_02775

Basic Information

• Species: Massilioclostridium methylpentosum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium methylpentosum
• CAZyme ID: MGYG000001332_02775
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1736		189316.7	4.3316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001332	3406391	Isolate	not provided	not provided

• Gene Location: Start: 646615; End: 651825 Strand: +

Full Sequence      

MNKSITSSSAVGNRRKTKLRTKVLAAILACAIAMPIAAPLTTYAAAIGEPLERSSVNFTN
RNEALKCSVLLPYINGDDVIGSTLTGQYTLSINSSSTNPGQNGDVSTYQWYIGDTRNGEY
TPIDGETARTYAIKDSDLNKYIRFEVTPKANGLTGKAIKSDPVGPIMSEEEFAKISPRLK
KTETYMESRNNLTSEITRRFSNVTYFTVDEKIGGTDNVGEALLNGSIYYYKNGTSMSFNE
AKPEVVDGVVMVNKAFVTNVLDAPDYDFAGKDTVALDDVAAALNKQVFYATEALKEGANG
NYRSTAQAEGLIVISDNPLDVDVVADRDVLNEMANQVYNLRATEEEMQWFHDAKLGMFIH
WDPGTMTGSEIGWGRGPGPRKVTSKNVGYDLAYLDFDPTEFDAQDIVAKAKEMGCKYLIF
TSKHHGGFASWNTNYFPEHSIMGTPYGQRAQEQEVDIVKQLAAAAHAQGLKFGLYYSPQD
WYNNYCWSEEHYRWMETYLGHLTELMGNYGEIDVFWCDAIGSALTMYNNTTPTGWKEAWG
AWDPRTILRRVKQLQPGIITNDRYVYRWEDPKPWDQGGLPEDIQGDYITPEQTTAGFDNK
HAWESCLTIDGGNAWSYNGNTGAKDPVRVTGDLINNTVNDGNVLLNMGLMWNGQFSSRHA
DAFAAVGQWAQDNAEAVYNTRGGPYVEPGWGGSTYRNNPDGTTTLYLHVSPKTRGSKVIT
GNVLNISNPPDGKEYTTASLLGQPDVEIGFEKTETGYTITLPEGMSFADGRTMETIDTII
KLEENLDAAIENAVKKANNFIEAMDGEGYPAALTSYRSVIEAKRDALSSAEGDDAKKAAL
SDIKTIFSAFDTATAIYEATVTNTELIGKQIVGSNSWELAPEMKASMEGRIEAAIAALTS
ATVNAEELTRILTGLNTDAEYLRSLANMTVVTFNPDSSYIQPESAIKLHTDNPDLAIYYT
LDGTEPTAQSKLYTGAITAPKQGAFQIKAAVFSGETQVGVTYQQYFFVNNSEEPANLLSG
AGITCSDETISAFQLAKVIDGNHNTETNFGAETNSLTLTFDLGAAKSFNTLMLYENYYIG
FNEVRNVTVESSEDGVNFTPLGTKWIQGVGSISFDTVKAQYVRVSMPACQGPILQEIELY
NVQKPDMSYLNLTSSASKFIPGAPVDFTVNGEINDAAVNPSDVVYVVEPAEAGVMKGNTL
RVSKDFEGAMISVTATVENGERTVRSNTVKLTTGANLTMDSVKADNYYSSDYVPEKAFDG
IMTTRWATKGTGAHWIDINYMETGYNRFVIREYLDDGIFRLPGKTRLTDFKLQYKDPNTG
EDVIIFDSANQTDYDVVYDRTSPTEIFPSSDPNLKYTYVDANGDIASTVHEFAFAKTIPS
NNIKLVSDRGEITFWEIEAYGSLTPPEPPASNKTILNKVIEKAEALLGTDEFNNAIQSVQ
DSFQAVLAEAKDVAGYDYSTQEEIDAAWVSLMTEIHKLGLQQGNKDQLREHVELYSELNL
DLYLDGDAKDNFVAALEAAKAMLENNDAVQSEVDAADDALVAAAQALVKRGDKTTLQSVV
DSTASYVEDHYAKGWAEFAAARDAANVVLENPNVTQEEVDAATDALIEAMLNLRLKADKS
LLNSVIAAAEALDLSGYTKASVEAFEAALNEAKATAADESLSVDEQNQVTEAVNRLSNAV
NNLKKADGSAANLSVNGDGSITGGSGSAKTGEATPIAMAMAALLLAGSAIIIKKRK

Enzyme Prediction     

No EC number prediction in MGYG000001332_02775.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	334	679	3e-71	0.9161849710982659

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	1.26e-57	347	719	20	380	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	7.27e-53	347	675	19	333	Alpha-L-fucosidase.
COG3669	AfuC	4.45e-22	342	753	11	394	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam13287	Fn3_assoc	1.61e-09	946	1005	1	59	Fn3 associated.
pfam00754	F5_F8_type_C	2.12e-09	1023	1131	2	117	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP73471.1	3.95e-123	70	783	15	694
QWP53852.1	3.95e-123	70	783	15	694
QWP03159.1	6.38e-123	70	783	32	711
QWP61036.1	6.38e-123	70	783	32	711
QWP68369.1	6.38e-123	70	783	32	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GN6_A	6.77e-36	340	721	24	390	Alpha-L-fucosidaseisoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_B Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_C Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_D Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_E Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_F Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus]
4JL2_A	3.60e-29	347	763	19	422	Crystalstructure of a bacterial fucosidase with a monovalent iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482],4JL2_B Crystal structure of a bacterial fucosidase with a monovalent iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482]
4PCS_A	4.11e-29	347	763	19	422	Crystalstructure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCS_B Crystal structure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCS_C Crystal structure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCS_D Crystal structure of a bacterial fucosidase with iminosugar (2S,3S,4R,5S)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_A Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_B Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_C Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482],4PCT_D Crystal structure of a bacterial fucosidase with iminocyclitol (2S,3S,4R,5S)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine [Bacteroides thetaiotaomicron VPI-5482]
2WVS_A	4.36e-29	347	763	23	426	Crystalstructure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_B Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_C Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_D Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482]
2WVT_A	4.36e-29	347	763	23	426	Crystalstructure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor [Bacteroides thetaiotaomicron VPI-5482],2WVT_B Crystal structure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor [Bacteroides thetaiotaomicron VPI-5482],2WVU_A Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_B Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_C Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_D Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5RFI5	1.54e-25	349	680	47	368	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
Q9BTY2	2.11e-25	349	763	49	447	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
Q99KR8	2.77e-23	349	766	43	436	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
C3YWU0	7.94e-22	349	681	33	356	Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2
P10901	2.14e-21	349	762	36	441	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004274	0.994551	0.000288	0.000481	0.000218	0.000182

TMHMM  Annotations     

start	end
23	45
1713	1732