CAZyme Information: MGYG000001335_01300

Basic Information

• Species: Lactobacillus ultunensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus ultunensis
• CAZyme ID: MGYG000001335_01300
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
167	MGYG000001335_47|CGC2	19133.17	9.4072

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001335	2168092	Isolate	not provided	not provided

• Gene Location: Start: 311266; End: 311769 Strand: +

Full Sequence      

MIFVTVGTHEQPFNRLIKKVDELVANGDIKEKVIIQTGFSTYVPQNCEAHKMMSFDEMQG
ALKKARIVITHGGPSSFIEALQFGKVPIVVPRQEKFHEHVNNHQVEFTKLIAKQMNNIIP
VYQITQLKETIENYNRIITTKKTGESSNNGKFIRKFEIIVDDLMHGH

Enzyme Prediction     

No EC number prediction in MGYG000001335_01300.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5017	COG5017	1.36e-26	1	121	1	121	UDP-N-acetylglucosamine transferase subunit ALG13 [Carbohydrate transport and metabolism].
pfam04101	Glyco_tran_28_C	5.88e-20	1	112	1	119	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.
cd03785	GT28_MurG	1.85e-06	11	104	194	288	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG1819	YjiC	4.84e-05	1	90	239	325	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	0.004	1	102	260	342	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQP28319.1	3.48e-119	1	167	1	167
AKG67380.1	2.94e-97	1	164	1	164
QYH34130.1	2.94e-97	1	164	1	164
QAU30587.1	2.91e-95	1	164	1	164
AFR22744.1	2.91e-95	1	164	1	164

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9NP73	4.60e-07	2	114	4	119	Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Homo sapiens OX=9606 GN=ALG13 PE=1 SV=2
Q9D8C3	1.15e-06	3	114	5	119	Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Mus musculus OX=10090 GN=Alg13 PE=1 SV=2
Q5I0K7	1.60e-06	3	114	5	119	UDP-N-acetylglucosamine transferase subunit ALG13 homolog OS=Rattus norvegicus OX=10116 GN=Alg13 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001335_01300.