CAZyme Information: MGYG000001335_01738

Basic Information

• Species: Lactobacillus ultunensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus ultunensis
• CAZyme ID: MGYG000001335_01738
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	MGYG000001335_48|CGC6	44056.5	10.2831

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001335	2168092	Isolate	not provided	not provided

• Gene Location: Start: 376734; End: 377966 Strand: +

Full Sequence      

MTKTKQFIAKLACATVIGTAGIALTQINRPVITVNASTTSVAARALGVDVASYQSADLSS
HARAGAQFAIVKVSEGTSYRNPKASSQISTALSNNMMPMAYHFATFSSNASAAAAEAQYA
IKAAQAFGLPKGSYIACDYETGQGNNIYGGKTPTANAIIAFMDQIKAAGYQPLLYASSSV
LQNQIDTNSVVAKYPNSLWVASYAISGRIDNPNFNYFPSMNGVSIWQFTDNWRGLNVDGN
VTVLPLSINGNVTSNNGAISQAPSSNANNTSTTKKEDKTDSKPASSTPSESATSAFVMKK
AYVYNKKGERQSGSYAAYTRITYYGSTTRLDNGKTAIKVGDDRYVMASNVLGNSRVIRHN
AYIYNHAGRRANWRVLRKGTPVKTYGSRFHINGKSYYRIGKGLYVKVANF

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	48	233	4.8e-44	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06415	GH25_Cpl1-like	6.10e-78	47	244	3	196	Cpl-1 lysin (also known as Cpl-9 lysozyme / muramidase) is a bacterial cell wall endolysin encoded by the pneumococcal bacteriophage Cp-1, which cleaves the glycosidic N-acetylmuramoyl-(beta1,4)-N-acetylglucosamine bonds of the pneumococcal glycan chain, thus acting as an enzymatic antimicrobial agent (an enzybiotic) against streptococcal infections. Cpl-1 belongs to the CP family of lysozymes (CPL lysozymes) which includes the Cpl-7 lysin. Cpl-1 has a glycosyl hydrolase family 25 (GH25) catalytic domain with an irregular (beta/alpha)5-beta3 barrel and a C-terminal cell wall-anchoring module formed by six similar choline-binding repeats (ChBr's). The ChBr's facilitate the anchoring of Cpl-1 to the choline-containing teichoic acid of the pneumococcal cell wall. Other members of this domain family have an N-terminal CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain similar to that of the firmicute CHAP lysins and associated with endopeptidase activity. The Cpl-7 lysin is also included here as is LysB of Lactococcus phage, and the Mur lysin of Lactobacillus phage.
pfam01183	Glyco_hydro_25	2.72e-25	48	231	1	174	Glycosyl hydrolases family 25.
cd00599	GH25_muramidase	2.40e-22	47	241	2	181	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
smart00641	Glyco_25	2.49e-19	131	250	1	109	Glycosyl hydrolases family 25.
cd06522	GH25_AtlA-like	1.17e-18	48	243	4	188	AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQP29265.1	4.93e-286	1	410	1	410
QFQ67646.1	4.35e-243	1	410	1	409
AEG40063.1	4.35e-243	1	410	1	409
QNT44827.1	1.02e-241	1	410	1	409
AEA32309.1	6.86e-240	1	410	1	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H09_A	6.41e-22	46	231	6	178	ChainA, LYSOZYME [Streptococcus phage Cp1]
2IXU_A	6.49e-22	46	231	7	179	ChainA, LYSOZYME [Streptococcus phage Cp1]
2IXV_A	1.65e-21	46	231	7	179	ChainA, LYSOZYME [Streptococcus phage Cp1],2J8F_A Chain A, LYSOZYME [Streptococcus phage Cp1],2J8G_A Chain A, LYSOZYME [Streptococcus phage Cp1]
1OBA_A	1.05e-20	46	231	7	179	ChainA, Lysozyme [Streptococcus phage Cp1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33486	2.41e-30	47	222	6	181	Lysozyme OS=Lactococcus phage mv1 OX=33769 GN=lysA PE=1 SV=3
Q8HA43	1.46e-24	48	244	157	343	D-alanyl-L-alanine endopeptidase OS=Streptococcus phage B30 OX=209152 PE=1 SV=2
P19385	2.51e-23	46	231	7	179	Lysozyme OS=Streptococcus phage Cp-7 OX=10748 GN=CPL7 PE=1 SV=2
P15057	3.55e-21	46	231	7	179	Lysozyme OS=Streptococcus phage Cp-1 OX=10747 GN=CPL1 PE=1 SV=2
P19386	3.55e-21	46	231	7	179	Lysozyme OS=Streptococcus phage Cp-9 OX=10749 GN=CPL9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.019345	0.975558	0.004306	0.000306	0.000241	0.000211

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001335_01738.