CAZyme Information: MGYG000001336_00023

Basic Information

• Species: Limosilactobacillus reuteri_E
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus reuteri_E
• CAZyme ID: MGYG000001336_00023
• CAZy Family: GH68
• CAZyme Description: Levansucrase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591		65465.34	4.5031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001336	2316838	Isolate	not provided	not provided

• Gene Location: Start: 14882; End: 16657 Strand: -

Full Sequence      

MNFSKAAKSGTQMTYNDLKKIGEALVDQDPKYAIPYFNASQIKNMPAAYTRDAETGEYAD
LDIWDSWPVQDPVTGYVSNWNGYQLVIAMMGRPHHEDNHIYLLYNKYGDNDFSHWRNAGS
IFGYNESPLTQEWSGSAIVNSDNSIQLFYTINDTNNAINHQKLASATMYLTADNDGVHIN
NVENNHVVFAGDGYHYQTYDQWKAANSFADNYTLRDGHVVQMPNGDRYLVFEGNTGTENY
QGEDQLYNWSNYGGNDRFNIESLFHLLSSDVDYKKAIFANGALGIIKLTNDEKNPQVEEV
YTPLVTSNMVSDELERPNVVKLGDKYYLFSATRLSRGTNIDTLNKANKVVGDNVAMIGYV
ADSLTGPYKPLNGSGVVVTASVPANWRTATYSYYAVPVEGKENQLLITSYMTNRGEVAGK
GMNSTWAPSFIVQINPDDTTMVLAKVTNQGDWIWDESSNNNNMLGNIQTAALPGEFGKPI
DWDLIGGYGLKPHDPATPNDPETPTTPETPETPNTPETPKTPENPGTPQTPDTPNTPEVP
LTPETPKQPETQTNNRLPQTGNNANKAMIGLGMGTLLSMFGLAGINKRRVN

Enzyme Prediction     

EC	2.4.1.10	2.4.1.9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH68	8	452	1.1e-148	0.9928057553956835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02435	Glyco_hydro_68	5.77e-133	10	444	3	411	Levansucrase/Invertase. This Pfam family consists of the glycosyl hydrolase 68 family, including several bacterial levansucrase enzymes, and invertase from zymomonas.
cd08997	GH68	2.17e-109	63	442	1	354	Glycosyl hydrolase family 68, includes levansucrase, beta-fructofuranosidase and inulosucrase. Glycosyl hydrolase family 68 (GH68) consists of frucosyltransferases (FTFs) that include levansucrase (EC 2.4.1.10), beta-fructofuranosidase (EC 3.2.1.26) and inulosucrase (EC 2.4.1.9), all of which use sucrose as their preferential donor substrate. Levansucrase, also known as beta-D-fructofuranosyl transferase, catalyzes the transfer of the sucrose fructosyl moiety to a growing levan chain. Similarly, inulosucrase catalyzes long inulin-type of fructans, and beta-fructofuranosidases create fructooligosaccharides (FOS). However, in the absence of high fructan/sucrose ratio, some GH68 enzymes can also use fructan as donor substrate. GH68 retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller. Biotechnological applications of these enzymes include use of inulin in inexpensive production of rich fructose syrups as well as use of FOS as health-promoting pre-biotics.
cd08979	GH_J	6.49e-21	64	431	1	290	Glycosyl hydrolase families 32 and 68, which form the clan GH-J. This glycosyl hydrolase family clan J (according to carbohydrate-active enzymes database (CAZY)) includes family 32 (GH32) and 68 (GH68). GH32 enzymes include invertase (EC 3.2.1.26) and other other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). The GH68 family consists of frucosyltransferases (FTFs) that include levansucrase (EC 2.4.1.10, also known as beta-D-fructofuranosyl transferase), beta-fructofuranosidase (EC 3.2.1.26) and inulosucrase (EC 2.4.1.9). GH32 and GH68 family enzymes are retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) and catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG4932	COG4932	4.75e-04	521	589	1460	1528	Uncharacterized surface anchored protein [Function unknown].
pfam00746	Gram_pos_anchor	8.23e-04	549	591	1	42	LPXTG cell wall anchor motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEI56232.1	0.0	1	591	1	591
AVK93185.1	0.0	1	591	212	802
CAH25436.2	0.0	1	591	208	798
ABQ01720.1	0.0	13	591	1	579
AMY15010.1	5.49e-284	1	591	1	591

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFR_A	4.22e-251	1	493	65	564	Crystalstructure of inulosucrase from Lactobacillus johnsonii NCC533 [Lactobacillus johnsonii],2YFT_A Crystal structure of inulosucrase from Lactobacillus johnsonii NCC533 in complex with 1-kestose [Lactobacillus johnsonii]
2YFS_A	2.42e-250	1	493	65	564	Crystalstructure of inulosucrase from Lactobacillus johnsonii NCC533 in complex with sucrose [Lactobacillus johnsonii]
6PWQ_A	1.26e-91	11	470	15	458	Crystalstructure of Levansucrase from Bacillus subtilis mutant S164A at 2.6 A [Bacillus subtilis],6PWQ_B Crystal structure of Levansucrase from Bacillus subtilis mutant S164A at 2.6 A [Bacillus subtilis]
3OM6_A	1.33e-91	11	456	16	455	ChainA, Levansucrase [Priestia megaterium],3OM6_B Chain B, Levansucrase [Priestia megaterium],3OM6_C Chain C, Levansucrase [Priestia megaterium],3OM6_D Chain D, Levansucrase [Priestia megaterium]
3OM7_A	2.63e-91	11	456	16	455	ChainA, Levansucrase [Priestia megaterium],3OM7_B Chain B, Levansucrase [Priestia megaterium],3OM7_C Chain C, Levansucrase [Priestia megaterium],3OM7_D Chain D, Levansucrase [Priestia megaterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74K42	4.47e-249	1	497	208	711	Inulosucrase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) OX=257314 GN=inuJ PE=1 SV=1
D3WYW0	5.50e-248	1	497	187	692	Levansucrase OS=Lactobacillus gasseri OX=1596 GN=levG PE=1 SV=1
D3WYV9	2.31e-245	1	497	202	705	Inulosucrase OS=Lactobacillus gasseri OX=1596 GN=inuGB PE=1 SV=1
Q70XJ9	4.12e-236	1	497	248	755	Levansucrase OS=Fructilactobacillus sanfranciscensis OX=1625 GN=levS PE=1 SV=1
P11701	7.00e-235	7	496	188	680	Levansucrase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=ftf PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
567	586