CAZyme Information: MGYG000001337_01437

Basic Information

• Species: Bacteroides fragilis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis
• CAZyme ID: MGYG000001337_01437
• CAZy Family: GH3
• CAZyme Description: Xylan 1,4-beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
883	MGYG000001337_2|CGC32	99134.68	6.8169

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001337	5115082	Isolate	not provided	not provided

• Gene Location: Start: 1155790; End: 1158441 Strand: -

Full Sequence      

MKNIFLTMSLGIGLLFPCKLHAQSQYPFQNTTLSTEERVDDLIKRMTLEEKIDLLSGYND
FYLHPCERLGIPAFKLADGPLGVASWGLFGRATAFPSALSLAASWNKNLAEKTGAMYAQE
WRARGIHFLLAPGVNNYRASKGARNFEYFGEDPYLASEMVVPFIKAVQDGGVIATIKHFA
ANDQEFDRYTVSTEVSERALQEIYLPPFKAAVQKAGVKAVMTGYNLVNGVYCTENKHLID
ILKKDWGFKGMLMSDWACTYSAENAANYGLDLEMGSNDWFTRKELLPLVKEGKVTEEVIN
DKVRRIYGACISMGFFDRPQQDTDIPTFNPQANQMALNTACEGIILLKNEQNTLPIHRPK
VIAVIGPTANPAIVSDRIYNVNSIVYGGGGSSKVHPWYVVSALEGIRQEFPEATVLYTEG
ISNQFKPRLFRNSKFRTKEGKPGLEASYYALSSDTSATLSDKMIQQQAVAAGRTVSVNQS
ADRTIETDKEESGLILRRTDRTVNYEWWGYPFNESKLGNDYRVCWEGYVDVEKTDSIRFF
VDAQGAYRLWIDGTLALDASQSQSFDVRNTAISAKKGDAKHIRLEFCNQRSTPAEIRMGY
AYQSDIDFSEAKRLAAKADLVVFCAGLDGSIELEGRDRPFDLPYGQDMLIQELVKVNPKL
IVAIHAGGGINMTRWIDQVPAVVHALYPGQEGGHALAHILSGKVNPSAKLPFTIEKRWED
SPACGHYDETRKEKKVYYTEGIFTGYRGYDQKGIEPLFPFGFGLSYTTFDYSGLNIRMTD
KKQKQLVVSFTVTNTGQRDGYEVAQLYVRDMQSKEPRPLKELKGFDKVYLKAGESKQIEI
GLSEDAFQYFNAKQNRWVFEKGEFEILVGASSKDIRLAEKIKM

Enzyme Prediction     

No EC number prediction in MGYG000001337_01437.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	67	274	2.8e-68	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	6.72e-91	1	879	1	761	beta-glucosidase BglX.
COG1472	BglX	7.83e-86	68	414	57	391	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.49e-64	16	840	30	740	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	4.13e-48	68	306	63	313	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	8.80e-46	600	746	73	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAH06603.1	0.0	1	883	1	883
QCQ40606.1	0.0	1	883	1	883
QCT77453.1	0.0	1	883	1	883
AKA50949.1	0.0	1	883	1	883
ANQ59588.1	0.0	1	883	1	883

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	4.27e-125	39	883	5	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
3AC0_A	1.12e-124	39	883	6	836	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.30e-121	39	883	6	836	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	1.82e-103	37	877	2	707	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.62e-102	37	877	2	707	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27034	2.07e-136	39	883	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
A1CA51	3.51e-136	39	875	6	822	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
Q2U8Y5	1.40e-135	39	875	6	823	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
B8NDE2	1.49e-134	39	875	6	823	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
A1DNN8	5.96e-133	36	862	11	834	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000208	0.999177	0.000158	0.000160	0.000143	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001337_01437.