CAZyme Information: MGYG000001337_04032

Basic Information

• Species: Bacteroides fragilis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis
• CAZyme ID: MGYG000001337_04032
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820	MGYG000001337_4|CGC2	91019.38	5.3152

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001337	5115082	Isolate	not provided	not provided

• Gene Location: Start: 194566; End: 197028 Strand: -

Full Sequence      

MKNVLTGLFLLILATACSEEEPQTITPVPFNQVTLTDGFWKNRMQTEINVTVPFSVEQSA
PAVERFRRCAAFLAGDSTALPETHRFISSDLYKVMEGVSYSLMIQPNKELEEFMDRVADL
IAASQKDDGYLYISHICGNPDPREMGEKPYSWVVHSHELYNVGHLYEAAVAYYQATGKDK
LLNVAIKSAKHVNKVFFEGGDPNYNGGKPINQAPGHEEIELALCKLYRVTNDPLYLDMAK
KFLEIRGVTYRPEGEGVMAPTYAQQHAPVKEQTEAVGHAVRAAYLYTAMAQVDALTGLND
YTKALNSIWTNLVTTRMHITGGLGAVEGMEGFGAPYELPNLTAYNETCAAVANVFFNYGM
YLDSGDAKFLDIAELSLFNNSLAGINLHGDRFFYVNPLEADGVRRFNHGNGGRAKWFGCA
CCPPNISRLILQVPGYMYAYSKDRVYLTLYGGSQTTIPLEGTRVKLEQTSAYPFDGKVRL
TVQPEKGSKFSVCMRIPTWARSDEFVPGGLYPYKQPKQAEVELSVNGQKTDFKMEKGFAV
IKRDWKPGDVVELNIPMPVRFVDCIPEVSENIGKTAVTRGPLVYCAEEVDNAGPVQRLYL
GDTNEAQAKVANISSGVLQGLERITLPGMEKKVGGITSREITMIPYYAWCNRGDNRTMLV
WLNEEASTASIGQQTMAYLRNVKGVNASSVAGGKNISVRALCDGKVSESSADKLTEQWLS
EGSGKQWVQVDFREPFLLNSLSVYWLDDQDKITVPSGWSVEYKSDAGWTPLELYVTDSYQ
MGTDRFNVVHPSGSLEVESVRILIEPQKGKSIGVSEIRFE

Enzyme Prediction     

No EC number prediction in MGYG000001337_04032.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	33	585	3.9e-188	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.45e-153	32	585	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.66e-146	23	665	1	588	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04791	LanC_SerThrkinase	8.46e-04	168	334	94	253	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ39560.1	0.0	1	820	1	820
CBW24678.1	0.0	1	820	1	820
QCT76448.1	0.0	1	820	1	820
QRP88136.1	0.0	1	820	1	820
BAD51114.1	0.0	1	820	1	820

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	8.42e-163	25	674	7	635	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	2.61e-133	33	665	16	648	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	7.86e-128	33	665	16	648	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	3.39e-96	33	652	3	647	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	4.46e-96	33	652	3	647	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.86e-95	33	652	3	647	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000074	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001337_04032.