CAZyme Information: MGYG000001338_00811

Basic Information

• Species: Blautia_A wexlerae_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A wexlerae_A
• CAZyme ID: MGYG000001338_00811
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000001338_1|CGC14	54278.2	4.9368

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001338	3930699	Isolate	not provided	not provided

• Gene Location: Start: 901942; End: 903366 Strand: -

Full Sequence      

MPTDQELIKIVPSSRQLAYQATEFYAFFHFGMNTYTNREWGDGTETPQIFNPTEFVADQW
VSAAQNAGMKGVILTCKHHDGFCLWPTRYTSHSVVSSPWKNGRGDVVWEVSEACRRYGMK
FGIYLSPWDRNKPCYGSGKEYDDYYLAQLTELLTGYGDIFSVWLDGACGEGPNGKKQIYD
WKRYYECVRKYQPDACICVCGPDIRWCGNEAGDVRKSEWSVVPARTALAESVQERSQQTD
DKEFRMRRITSDMEDLGSRRALEGETNLIWYPAEVNTSIRPGWFYHPEEDDQVKSLEELI
YIYIGAVGGNATFLLNIPPMPNGLLHENDVKRLEEFGSWKKKSFTHNLMSTAHIFSENED
PTHPVSDLTDDTSETWFQPESSELPVEITICLDGSYNLGYLVLKEAVCYSQRVEKFEIFV
KEGEIWNSIYTGTVIGYKKIISVKGQKAQKVKIVLHDFRVLPLLSFVGIYPESL

Enzyme Prediction     

EC	3.2.1.111	3.2.1.51

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	15	342	2.7e-84	0.861271676300578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	5.04e-67	12	470	11	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	2.03e-43	50	342	79	330	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	5.47e-40	50	342	76	332	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET79943.1	1.12e-201	1	470	1	468
ABX43385.1	7.72e-200	4	470	5	469
QQR31700.1	1.40e-196	4	470	8	445
ASB42413.1	1.40e-196	4	470	8	445
ANU54367.1	1.40e-196	4	470	8	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UES_A	2.81e-161	7	465	14	471	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	3.70e-159	7	465	14	471	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	2.26e-158	7	465	16	473	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
4ZRX_A	3.38e-144	9	470	29	458	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
5K9H_A	2.68e-98	11	470	38	463	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	5.91e-104	11	473	37	480	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	6.68e-96	11	473	39	479	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
C3YWU0	2.55e-08	46	166	93	214	Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2
P10901	6.08e-08	55	166	105	223	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
P48300	5.80e-07	46	206	111	293	Tissue alpha-L-fucosidase OS=Canis lupus familiaris OX=9615 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001338_00811.