CAZyme Information: MGYG000001338_02625

Basic Information

• Species: Blautia_A wexlerae_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A wexlerae_A
• CAZyme ID: MGYG000001338_02625
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		37046.83	7.7028

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001338	3930699	Isolate	not provided	not provided

• Gene Location: Start: 2877795; End: 2878802 Strand: -

Full Sequence      

MRLKRILIIGTIFPVLFSIILFFGILISGEDDDSSNSYLPVYSGMNLSADVLKHQPMVEK
YARENGISEYVNVLLAIIQVESGGTATDVMQSSESLGLPPNSLSTEESIKQGCKYFASLL
SSCKAKGMTDINVVIQSYNYGGGYADYVAKNGKKHSFNLAENFAKNKSGGTKVTYTNPIA
VSKNGGWRYNYGNMFYVELVNQYLTVKQFSNETVQAVMNEALKYQGWKYVYGGSNPNTSF
DCSGLTQWCYGKAGISLPRTAQAQYDATQHIPLSQAQAGDLVFFHSTYNTSDYVTHVGIY
VGNNQMYHAGNPIGYTDLTSAYWQQHIICVGRIKQ

Enzyme Prediction     

No EC number prediction in MGYG000001338_02625.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	2.36e-73	48	204	1	165	Lysozyme-like.
cd16891	CwlT-like	2.27e-69	54	204	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam00877	NLPC_P60	3.33e-38	226	332	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK13914	PRK13914	1.08e-32	210	333	362	481	invasion associated endopeptidase.
COG0791	Spr	1.16e-27	213	330	74	196	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV22434.1	1.08e-242	1	335	1	335
QRT48620.1	4.38e-242	1	335	1	335
QCU01134.1	1.03e-240	1	335	1	335
BCL58700.1	1.03e-240	1	335	1	335
SQI08877.1	3.46e-207	1	335	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	1.05e-182	30	335	3	308	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	6.23e-136	29	333	1	310	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
7CFL_A	2.50e-16	216	333	16	137	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
6BIQ_A	7.20e-14	226	320	167	264	Structureof NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_B Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_C Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_D Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis]
6BIO_A	5.09e-12	226	317	167	261	Structureof NlpC1 from Trichomonas vaginalis [Trichomonas vaginalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	7.46e-74	42	334	48	329	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
Q01836	1.02e-22	216	333	354	467	Probable endopeptidase p60 OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=iap PE=3 SV=2
P21171	1.13e-22	217	333	372	484	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2
Q01839	6.20e-22	220	333	415	524	Probable endopeptidase p60 OS=Listeria welshimeri OX=1643 GN=iap PE=3 SV=1
O34636	1.25e-21	39	202	40	202	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.915874	0.078244	0.003685	0.000284	0.000200	0.001744

TMHMM  Annotations     

start	end
7	29