CAZyme Information: MGYG000001339_00283

Basic Information

• Species: Acetomicrobium hydrogeniformans
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Acetomicrobiaceae; Acetomicrobium; Acetomicrobium hydrogeniformans
• CAZyme ID: MGYG000001339_00283
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	MGYG000001339_1|CGC1	36615.05	8.9094

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001339	2123925	Isolate	not provided	North America

• Gene Location: Start: 275875; End: 276867 Strand: -

Full Sequence      

MRIDQNKIERVLVIGLSCLGDMVMASAALWNLRLFLPKAEFTLWVGPRALAALSEDPMWD
KIRIYDRGGEFSGFKGRLRAIKLMRQEKYDLIVDLRATAMPLFSGARYAPLWGLREVFLP
KTLHEAERTLQALTSLGIPIRIRQLRFFVPFETKEMVKTKYKDELKDRKLVIFNPGANWP
PKRWPVEGFVSLGKRLISEFGAVIGVIGYSEEERALGMEVLKGLQEINALDLTGKVPLTE
LGALLGMASLFVTNDTGTLHIGSAVGVPVVGLYGPSSPERYGPWGTRHRVVAPSLPCAPC
VGKECVYGDFACMSKIGVDEVFSACAELLV

Enzyme Prediction     

No EC number prediction in MGYG000001339_00283.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	79	310	8.3e-55	0.9688888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	3.11e-72	10	325	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	5.02e-54	10	329	3	330	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.35e-37	77	308	1	244	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	7.55e-35	10	330	1	334	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	4.34e-19	7	284	4	299	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFM22083.1	3.84e-190	1	329	1	329
AER66303.1	2.42e-130	1	329	1	329
ADE57603.1	1.13e-111	1	329	1	332
ACZ19921.1	1.70e-90	1	329	1	315
ACM20470.1	1.05e-43	11	329	3	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.48e-20	9	329	9	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
1PSW_A	7.34e-16	10	291	2	305	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	1.57e-17	11	291	3	305	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37692	1.02e-16	10	291	2	305	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P37421	2.57e-16	10	291	2	305	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
Q57336	1.82e-14	13	292	13	300	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
Q9R9D5	5.81e-14	20	287	5	290	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000007	0.000001	0.000000	0.000000	0.000004

TMHMM  Annotations     

start	end
12	34