CAZyme Information: MGYG000001339_00504

Basic Information

• Species: Acetomicrobium hydrogeniformans
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Acetomicrobiaceae; Acetomicrobium; Acetomicrobium hydrogeniformans
• CAZyme ID: MGYG000001339_00504
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
495		55739.34	6.388

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001339	2123925	Isolate	not provided	North America

• Gene Location: Start: 514998; End: 516485 Strand: +

Full Sequence      

MSSPFKKIKVLHVASEMHPLAKKGGLGDVVGSLPKAQRELGIDSRVLLPLYPGVMDRIIG
KAKKLPRKLYLPLEWRVFPARLWHTDVQEVPVYLLDIEDISFSADVYPNQLDMNSVRPFF
LLSLAAMEFKKATNWNPHIFHIHDWPTSMVATVLKWHMYYSTLSNHYDTVLTIHNLAHQG
IVQETNLIQWGIPKEAFNIEGLEYYGMTNFLKGGIIASDMVTTVSPRYSWEIQTREYGMG
LDGVLKKYNSKLKGILNGIDYSYWNPKTDPLIPAHYDVNDIAPKRECKKSLLSRCGWEDD
GSPILIYIGRLAEQKGLDILLPSIEAIPGHGCKLIVLGEGSEIYERALLDMCLQFPDSLF
VKIGYDEELSHLMYAGGDMLVMPSYFEPCGLSQLIAMRYGTVPICRATGGLADTVIDADS
ASDGTGFLFSSYDSEAFLRAIGRALASWNSPNHWNRIISNCMKVDFSWSKSSREYANLYL
ELLGVPEGENKNLLL

Enzyme Prediction     

No EC number prediction in MGYG000001339_00504.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	9	479	2.6e-164	0.9936440677966102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	8	482	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	9	484	2	465	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	9	481	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	7.16e-164	9	484	2	480	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	1.04e-131	8	483	4	480	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFM22282.1	1.20e-288	1	487	6	492
ACZ18778.1	2.04e-183	1	484	1	487
QVL35419.1	4.73e-179	9	485	9	487
QTX31612.1	5.44e-178	9	485	9	487
ANZ44420.1	4.89e-175	8	483	9	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RZU_A	6.90e-100	8	483	1	476	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
3D1J_A	6.73e-98	8	482	1	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.69e-97	8	482	1	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	1.33e-96	8	482	1	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
1RZV_A	2.29e-94	10	483	3	476	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZV_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5YG91	1.02e-114	8	487	1	491	Glycogen synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) OX=289376 GN=glgA PE=3 SV=1
A5UBW8	6.04e-114	8	482	1	476	Glycogen synthase OS=Haemophilus influenzae (strain PittEE) OX=374930 GN=glgA PE=3 SV=1
Q4QK70	3.40e-113	8	482	1	476	Glycogen synthase OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=glgA PE=3 SV=1
A5UEJ5	2.15e-111	8	482	1	476	Glycogen synthase OS=Haemophilus influenzae (strain PittGG) OX=374931 GN=glgA PE=3 SV=1
Q65TI3	3.13e-111	8	479	1	474	Glycogen synthase OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001339_00504.