CAZyme Information: MGYG000001339_01271

Basic Information

• Species: Acetomicrobium hydrogeniformans
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Acetomicrobiaceae; Acetomicrobium; Acetomicrobium hydrogeniformans
• CAZyme ID: MGYG000001339_01271
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283	MGYG000001339_1|CGC8	30992.56	4.7376

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001339	2123925	Isolate	not provided	North America

• Gene Location: Start: 1281202; End: 1282053 Strand: +

Full Sequence      

MAKRTTLRRTIEVKGKGLHSGRESAITLIPSYRESGIMICASKGKNLYPIGDCELFSPGR
STCLVLPDGEIIYTVEHLLASLYGMGVDDAVVVVEGGEVPIFDGSALPWAERIKDAGLAE
KDDGEEEPINLSSPLLVEDDEAGAWVACFPSDVLKVSYIISFDNDFIGTQVFSSVVTEET
FLKDFAPARTFVRLEDVDELKKQGLALGGSLDNALVFDDKGLVNDTFLRFENECVRHKAV
DLLGDLSLVGKLLCAHVVGFKAGHRLHLRMVERLKRLCRGDMS

Enzyme Prediction     

No EC number prediction in MGYG000001339_01271.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	5	275	2.2e-81	0.988929889298893

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03331	LpxC	5.09e-100	4	274	1	269	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
PRK13186	lpxC	2.38e-93	1	274	1	272	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
COG0774	LpxC	4.15e-83	1	274	1	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
TIGR00325	lpxC	1.65e-64	3	274	2	271	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK13188	PRK13188	1.32e-63	1	276	2	300	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFM20969.1	1.36e-120	3	283	4	284
ADE57621.1	1.71e-67	6	277	6	274
ANZ46625.1	2.22e-66	6	277	3	270
AMD95943.1	7.62e-61	3	274	2	275
ASQ49101.1	1.08e-60	3	274	2	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J3D_A	1.80e-48	1	274	1	274	Pseudomonasaeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1],4J3D_B Pseudomonas aeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1]
5U3B_A	1.90e-48	1	274	1	274	Pseudomonasaeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],5U3B_B Pseudomonas aeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],6MAE_A CHAIN A. UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase PA-LPXC Complexed with (R)-3-((S)-3-(4-(cyclopropylethynyl)phenyl)-2-oxooxazolidin-5-yl)-N-hydroxy-2-methyl-2-(methylsulfonyl)propenamide [Pseudomonas aeruginosa PAO1]
7K99_A	2.11e-48	1	274	1	274	CrystalStructure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K99_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K9A_A Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1],7K9A_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1]
5UPG_A	2.17e-48	1	274	2	275	Crystalstructure of LpxC from Pseudomonas aeruginosa in complex with PF-5081090 [Pseudomonas aeruginosa PAO1],6C9C_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with racemic ligand PT803 [Pseudomonas aeruginosa UCBPP-PA14],6CAX_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with PT805 [Pseudomonas aeruginosa],6DUI_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with PT801 [Pseudomonas aeruginosa LESB58],6E54_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with ligand PT802 [Pseudomonas aeruginosa PAO1]
5U39_A	6.74e-48	3	274	5	276	Pseudomonasaeruginosa LpxC in complex with CHIR-090 [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8F3U4	3.05e-57	4	281	7	281	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) OX=189518 GN=lpxC PE=3 SV=1
Q72RV5	3.05e-57	4	281	7	281	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) OX=267671 GN=lpxC PE=3 SV=2
Q04T70	3.41e-56	4	281	7	281	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) OX=355277 GN=lpxC PE=3 SV=1
Q051J2	3.41e-56	4	281	7	281	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) OX=355276 GN=lpxC PE=3 SV=1
B0S9V0	4.95e-56	4	272	7	273	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) OX=355278 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001339_01271.