CAZyme Information: MGYG000001339_01521

Basic Information

• Species: Acetomicrobium hydrogeniformans
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Acetomicrobiaceae; Acetomicrobium; Acetomicrobium hydrogeniformans
• CAZyme ID: MGYG000001339_01521
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333	MGYG000001339_1|CGC11	36538.76	8.8837

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001339	2123925	Isolate	not provided	North America

• Gene Location: Start: 1523614; End: 1524615 Strand: +

Full Sequence      

MAGYNPPLGTKDEKILFIRYSALGDVVRAIPMAAAIKEALPKVSLTWLLVHPYEELIEGQ
PYVDDVLVWDRKQGFKGFVRLILNIRRGGFTHMVSMQGTDRSAVMALFSGIKNRAGRHNW
ASFVYNMPSEDMAQILGRPVKVEKGRVYYQVSNELHRFADELLSATSRPRVACVIGASKI
VKRWPARCWAELASMVASSGGSAVLLGHGEQECDMAKEITSLLPKEFQEKAVDLTGKLKL
DEMAAVIGACDVVIGGDTGPMHLALALHKPVVGLFGPTLPNQVGLEGIDVKLISGCKCAG
CKNWDCGRDCLSSIKPKDVFKALAKLKFHEFIR

Enzyme Prediction     

No EC number prediction in MGYG000001339_01521.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	80	307	6.7e-45	0.9511111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	2.72e-63	14	323	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	1.69e-57	14	326	3	329	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
TIGR02193	heptsyl_trn_I	9.41e-38	14	287	1	292	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	2.36e-34	80	280	3	214	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	2.21e-29	14	326	1	332	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFM21221.1	4.57e-198	1	333	1	331
AER66301.1	2.04e-85	12	326	11	322
ANZ45851.1	6.62e-55	13	326	5	315
CBL28970.1	4.67e-45	13	333	10	325
ACZ19917.1	1.06e-42	13	284	6	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	3.89e-14	23	284	19	296	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
1PSW_A	5.22e-14	84	295	75	310	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
2GT1_A	2.01e-13	14	287	2	291	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	2.01e-13	14	287	2	291	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	2.13e-13	14	287	2	291	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	1.38e-18	7	275	2	281	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P45042	7.67e-17	127	295	143	310	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37692	1.04e-14	14	295	2	310	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P44011	1.38e-14	13	282	2	292	Putative glycosyltransferase HI_0523 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0523 PE=3 SV=2
P26469	1.47e-14	14	287	2	291	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001339_01521.