CAZyme Information: MGYG000001339_01903

Basic Information

• Species: Acetomicrobium hydrogeniformans
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Acetomicrobiaceae; Acetomicrobium; Acetomicrobium hydrogeniformans
• CAZyme ID: MGYG000001339_01903
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000001339_1|CGC14	40966.92	8.7356

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001339	2123925	Isolate	not provided	North America

• Gene Location: Start: 1882621; End: 1883730 Strand: +

Full Sequence      

MGNKLKMLFVAGGTGGHILPAVSFGNWIEEMKLPAEIIYLCGNRMLEQKIYNALNIEPIT
LSLSGSPFGVKGLRSFIRWKELIFSLVKIRNIVRNIKPDLIVLFGGYLSVPFALMTSLLR
VPMIAHEQNAVAGKSTRLCSRKGMLIITGWEECINLGKSDFRHVGIPVRKFNIIKKQKAW
ETLGGDGVLPPKKRFSLVMGGSIGGESLKHAVMEVAKRESLKNHIFMLLGPEGKHGIRWI
SDNVIVLPQAWDLSAHFSLADYVVTRCGASTLSELICYHVPSVLVPWEEASDNHQLANAE
IFLRSGIGTVWQERNGLDLLEEAILEVSDKCRSGIDQNMCDEKRNDICARFWSVVSSFST
KGEGPIGCF

Enzyme Prediction     

No EC number prediction in MGYG000001339_01903.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	197	329	4.7e-26	0.8535031847133758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03785	GT28_MurG	9.36e-70	6	330	1	324	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	8.16e-53	4	327	1	321	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
TIGR01133	murG	2.36e-52	6	333	2	325	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	6.19e-49	6	331	2	325	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam03033	Glyco_transf_28	5.28e-20	8	142	2	133	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFM21517.1	8.23e-171	1	367	1	364
ADE56952.1	2.98e-81	6	357	3	355
AER66711.1	3.67e-78	4	327	7	326
QTX33536.1	4.20e-77	5	356	4	355
QVL37391.1	4.20e-77	5	356	4	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	6.92e-29	4	315	2	308	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	4.89e-24	7	313	12	318	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	2.21e-18	2	313	4	307	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7IHN7	8.36e-37	5	334	2	314	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Thermosipho africanus (strain TCF52B) OX=484019 GN=murG PE=3 SV=1
A3DE27	8.87e-37	5	324	1	326	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=murG PE=3 SV=1
Q8R9G6	2.19e-33	5	315	1	317	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=murG PE=3 SV=1
A4XI04	2.45e-33	4	306	5	312	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) OX=351627 GN=murG PE=3 SV=1
B0K3H0	1.13e-32	5	315	1	317	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Thermoanaerobacter sp. (strain X514) OX=399726 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001339_01903.