CAZyme Information: MGYG000001340_01483

Basic Information

• Species: Weissella paramesenteroides
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Weissella; Weissella paramesenteroides
• CAZyme ID: MGYG000001340_01483
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491	MGYG000001340_13|CGC1	55356.2	4.9383

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001340	1962181	Isolate	not provided	not provided

• Gene Location: Start: 66852; End: 68327 Strand: +

Full Sequence      

MTWTREKRYQPYSAYSEIIKQSLEKKVATSIYKPGFHISPASGLLNDPNGFSYYNGQWHV
FYQAFPFGAVHGLKSWVHCISDDLVHWHNLGIALQPGGQFDSHGAYSGSAQVIDDQLFLM
YTGNVRDNDWHRSSFQLGAWMNKHNEITKINAPLITAPKHVTDHFRDPQLLKINGTYYAL
IGAQDKQSLRGEFSLYRSDNLKDWQDMGYVQHELGDLGYMIECPNLVYVNDKVVLIFCPQ
GISKDNLQVANIYPNVYAIGSELDLETGKWQAEQQTIVQLDDGFDVYASQAFNAPDGNAY
LISWVGLPEIEYPTDQENWAHCLSLVKQLKVVNNQLYQLPVPAMSTLADAEEILSENQQQ
LVADAGQQYELKLNLAANQTGNLLLVSDGTTAHSLQLKFDTNDEGYLIVDRSNVGEKFAT
SYGETRQILLNTHQALTLDIFIDHSICEIFINGGEKVMTLRFFAPQQQTMIAFAGQNTIK
YSGSYLSLSNM

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	37	340	3.7e-81	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01322	scrB_fam	0.0	23	463	4	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	3.65e-148	5	471	1	466	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
cd18623	GH32_ScrB-like	1.76e-142	43	333	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
pfam00251	Glyco_hydro_32N	1.49e-122	37	340	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	1.57e-117	37	454	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPI46097.1	0.0	1	491	1	491
ATF41096.1	0.0	1	491	1	491
APS42018.1	1.33e-292	1	491	1	491
CCC57154.1	1.33e-292	1	491	1	491
QEA57929.1	4.79e-260	1	491	1	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NU7_A	3.34e-177	1	491	1	488	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7VCO_A	8.14e-65	32	491	25	488	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	2.98e-64	16	464	26	461	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	4.37e-63	16	464	26	461	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	3.69e-46	31	454	1	397	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43471	1.05e-155	1	478	1	476	Sucrose-6-phosphate hydrolase OS=Pediococcus pentosaceus OX=1255 GN=scrB PE=3 SV=2
P13522	1.92e-137	8	488	8	477	Sucrose-6-phosphate hydrolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=scrB PE=3 SV=3
Q04937	5.09e-136	1	480	1	465	Sucrose-6-phosphate hydrolase OS=Lactococcus lactis subsp. lactis OX=1360 GN=scrB PE=1 SV=1
Q05936	2.54e-104	3	482	4	485	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	9.09e-99	3	463	7	453	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001340_01483.