CAZyme Information: MGYG000001341_01707

Basic Information

• Species: Leuconostoc mesenteroides
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Leuconostoc; Leuconostoc mesenteroides
• CAZyme ID: MGYG000001341_01707
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304		34854.37	9.3233

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001341	1638558	Isolate	not provided	not provided

• Gene Location: Start: 464493; End: 465407 Strand: -

Full Sequence      

MLITMLAAQKNQATQSDFDKFVVYYKNHTLSEQNHLMACKQNQSNNEMKTLAENNTNVTD
GDMDIAYALLMADQKWGSTGNFNYKKIATNILSDLLKHNYNDENELLRVGNWAKNDEKYN
NLIRTSDLIPSYFKKFYEVTNDKRWQKIYLKSIKVLKNLSGENKTGLIPDFVFITHNNIS
SVSPNTFESANDDKYAWNANRVPLRLAFNTSNKELKNINKKMLIFFNQQKSIKTVYSLDG
HSANNYSSMAFTAPIAVAAYQQKSEFKNFSNALLEQVDSNDLSNSYYADTLKVLAALMIK
NDLK

Enzyme Prediction     

No EC number prediction in MGYG000001341_01707.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	1	298	9.1e-58	0.88125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	1.72e-10	15	297	50	317	Glycosyl hydrolases family 8.
COG3405	BcsZ	6.31e-08	57	226	112	275	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUY16539.1	7.18e-214	1	304	48	351
AKP37085.1	1.08e-213	1	304	59	362
ARR89399.1	1.45e-213	1	304	48	351
APE77532.1	8.06e-213	1	304	9	312
QXC53575.1	8.37e-213	1	304	48	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	6.37e-41	1	302	101	405	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	4.76e-23	1	302	80	380	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	5.26e-23	1	302	86	386	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
1CEM_A	3.61e-15	59	302	119	355	ChainA, CELLULASE CELA (1,4-BETA-D-GLUCAN-GLUCANOHYDROLASE) [Acetivibrio thermocellus],1IS9_A Chain A, endoglucanase A [Acetivibrio thermocellus]
1KWF_A	8.96e-15	59	302	119	355	ChainA, Endoglucanase A [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	1.85e-39	1	302	101	405	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	3.29e-24	59	302	190	436	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
A3DC29	7.25e-14	59	302	151	387	Endoglucanase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celA PE=1 SV=1
P37701	2.08e-09	59	297	154	383	Endoglucanase 2 OS=Ruminiclostridium josui OX=1499 GN=celB PE=3 SV=1
P37699	2.79e-09	59	297	154	383	Endoglucanase C OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.940987	0.057551	0.000792	0.000234	0.000117	0.000324

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001341_01707.