CAZyme Information: MGYG000001342_00238

Basic Information

• Species: Streptococcus gordonii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii
• CAZyme ID: MGYG000001342_00238
• CAZy Family: GT8
• CAZyme Description: Glycosyltransferase stabilizing protein Gtf2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000001342_2|CGC5	47044.94	4.7484

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001342	2230611	Isolate	not provided	not provided

• Gene Location: Start: 246362; End: 247567 Strand: +

Full Sequence      

MKSIVLAGDYGYIRQIETTIKSLCCYHEDLLIYVFNQDIPQEWFINTRKKVKGTGNNLLD
IKLLRDDLRMKWEESTYSHINYMAYARYFIPEYVKADRALYLDCDLVVTQNLDHLFDLDL
EDYYIAAVRATFGLGIGFNSGVMLLNNKRWREENISQQLVELTDREIERVLEGDQSILNM
LFVGQYLELEDSYNFQIGFDMGAAQYGHDFVFDIPLSPLPAIVHYISALKPWNLLTNMRL
REVWWFYNDLDWTTIIASKTLKGIEKHGQDLDQVYKKELLTLTNSDSLERIKELIQALPD
CLFHIAAYSDMSDRLISLLSYENVRLHRLVLPIPLKQLAVACDLYLDINHDHKFRDFLEM
IEKQGKPIFAFETTQTEGITERIFATDKYQEMIEAIRQYPS

Enzyme Prediction     

No EC number prediction in MGYG000001342_00238.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	3	233	4.3e-54	0.867704280155642

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	3.12e-70	2	233	1	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	3.44e-58	2	298	3	317	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	4.81e-36	4	233	2	249	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
PRK15171	PRK15171	4.86e-20	82	232	105	270	lipopolysaccharide 3-alpha-galactosyltransferase.
cd06429	GT8_like_1	7.62e-17	41	247	45	255	GT8_like_1 represents a subfamily of GT8 with unknown function. A subfamily of glycosyltransferase family 8 with unknown function: Glycosyltransferase family 8 comprises enzymes with a number of known activities; lipopolysaccharide galactosyltransferase lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase and inositol 1-alpha-galactosyltransferase. It is classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALD72106.1	1.08e-292	1	401	4	404
AOS71855.1	1.08e-292	1	401	4	404
SQF28358.1	1.74e-292	1	401	35	435
ATF65112.1	5.60e-292	1	401	1	401
ARC47196.1	5.60e-292	1	401	1	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GVW_A	2.77e-137	2	399	6	404	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVV_A	2.22e-131	2	399	6	404	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
1SS9_A	1.86e-15	4	233	3	253	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	1.13e-14	4	233	3	253	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
5E9U_B	2.60e-12	272	374	281	383	Crystalstructure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_D Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_F Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_H Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2URJ6	1.52e-136	2	399	6	404	Glycosyltransferase GlyE OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyE PE=1 SV=1
A0A0H2URB1	3.91e-94	2	399	3	397	Glycosyltransferase GlyD OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyD PE=1 SV=1
A0A0H2URA3	1.05e-90	2	399	4	401	Glycosyltransferase GlyB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyB PE=3 SV=1
A0A0H2URH7	9.06e-85	2	398	303	693	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
A0A0H2URH2	1.32e-77	2	397	3	393	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001342_00238.