CAZyme Information: MGYG000001342_01977

Basic Information

• Species: Streptococcus gordonii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii
• CAZyme ID: MGYG000001342_01977
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
216		23115.45	4.1466

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001342	2230611	Isolate	not provided	not provided

• Gene Location: Start: 412763; End: 413413 Strand: -

Full Sequence      

MKKIFIKTALVVASTALSAIAGLQVAHADSYVVQQGDSFFGIASAHGMSPYDLAAKNGKS
IFDTINPGDVLEVDGATSTYANSGYGVSSNADLVSDVDDVVLNTPTDYGNSYPIGQCTWG
VKELAPWASNWWGNANTWAINASNQGYVTGTVPTVGAIAVWDGGEYGHVAYVTDVQSDGT
IQVLEANYNRQKQIDNYRGYFNPNEFLGNVTYIYPN

Enzyme Prediction     

No EC number prediction in MGYG000001342_01977.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	2.12e-26	46	215	1	172	Surface antigen [Cell wall/membrane/envelope biogenesis].
pfam05257	CHAP	7.16e-18	108	187	1	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.
PRK08581	PRK08581	3.92e-16	111	187	507	593	amidase domain-containing protein.
cd00118	LysM	1.40e-08	30	73	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	2.05e-07	31	73	2	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATF64328.1	2.33e-157	1	216	1	216
SQF26755.1	2.33e-157	1	216	1	216
VEE20293.1	2.33e-157	1	216	1	216
ARC46439.1	2.33e-157	1	216	1	216
QGS44587.1	2.33e-157	1	216	1	216

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CGK_A	3.37e-34	78	214	248	390	Crystalstructure of the essential protein PcsB from Streptococcus pneumoniae [Streptococcus pneumoniae D39],4CGK_B Crystal structure of the essential protein PcsB from Streptococcus pneumoniae [Streptococcus pneumoniae D39]
2K3A_A	7.85e-18	77	189	6	130	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
2LRJ_A	2.25e-16	109	188	8	88	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
5T1Q_A	1.24e-07	112	187	248	333	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DVU8	7.58e-60	1	216	1	211	Putative hydrolase SMU_367 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=SMU_367 PE=3 SV=1
P0C1U7	3.40e-22	31	198	160	320	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus OX=1280 GN=sle1 PE=3 SV=1
Q7A7E0	3.40e-22	31	198	160	320	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain N315) OX=158879 GN=sle1 PE=1 SV=1
Q7A1T4	3.40e-22	31	198	160	320	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MW2) OX=196620 GN=sle1 PE=3 SV=1
Q5HIL2	3.40e-22	31	198	160	320	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain COL) OX=93062 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000230	0.999123	0.000201	0.000154	0.000148	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001342_01977.